1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-17
  5. IL-17F
  6. IL-17F, Rat (sf9, His)

Rat IL-17F is predicted to have cytokine binding and dimerization activities and is involved in bacterial defense, IL-17-mediated signaling, and regulation of cytokine production. It acts upstream of the inflammatory response, and its homologue to human IL17F has been implicated in chronic mucocutaneous candidiasis. IL-17F, Rat (sf9, His) is the recombinant rat-derived IL-17F, Rat, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Rat IL-17F is predicted to have cytokine binding and dimerization activities and is involved in bacterial defense, IL-17-mediated signaling, and regulation of cytokine production. It acts upstream of the inflammatory response, and its homologue to human IL17F has been implicated in chronic mucocutaneous candidiasis. IL-17F, Rat (sf9, His) is the recombinant rat-derived IL-17F, Rat, expressed by E. coli , with N-6*His labeled tag.

Background

IL-17F, Rat is predicted to possess cytokine binding activity, protein dimerization activity, and signaling receptor binding activity. The gene is anticipated to participate in various processes, including the defense response to bacterium, interleukin-17-mediated signaling pathways, and the regulation of cytokine production. It is predicted to act upstream of or within positive regulation of cytokine production involved in the inflammatory response and positive regulation of transcription by RNA polymerase II. The anticipated subcellular location is in the extracellular space. As the ortholog of human IL17F (interleukin 17F), IL-17F, Rat is implicated in chronic mucocutaneous candidiasis. Despite its functional significance, low expression levels have been observed in the reference dataset, suggesting that its regulatory functions may be tightly controlled or context-dependent.

Biological Activity

Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 45.19 ng/mL, corresponding to a specific activity is 2.212×104 U/mg.

  • Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 45.19 ng/mL, corresponding to a specific activity is 2.212×104 U/mg.
Species

Rat

Source

E. coli

Tag

N-6*His

Accession

NP_001015011.2 (A28-A161)

Gene ID
Molecular Construction
N-term
6*His
IL-17F (A28-A161)
Accession # NP_001015011.2
C-term
Protein Length

Full Length of Mature Protein

Synonyms
IL-17F, Rat (sf9, His)
AA Sequence

ARRNPKVGLSALQKAGNCPPLEDNSVRVDIRIFNQNQGISVPRDFQNRSSSPWDYNITRDPDRFPSEIAEAQCRHSGCINAQGQEDGSMNSVPIQQEILVLRREPQGCSNSFRLEKMLIKVGCTCVTPIVHHAA

Molecular Weight

Approximately 18 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 4 mM HCL, pH 2.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-17F, Rat (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-17F, Rat (sf9, His)
Cat. No.:
HY-P74829A
Quantity:
MCE Japan Authorized Agent: