1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-17
  5. IL-17C
  6. IL-17C Protein, Human (HEK293, His)

IL-17C is an early response cytokine in the defense against bacterial pathogens and upregulates the expression of a variety of antimicrobial peptides. IL-17C stimulates the release of cytokines and is implicated in autoimmune disorders and bacterial infections. IL-17C Protein, Human (HEK293, His) is a recombinant human IL-17C protein with His tag at the C-terminus and is expressed in HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-17C is an early response cytokine in the defense against bacterial pathogens and upregulates the expression of a variety of antimicrobial peptides. IL-17C stimulates the release of cytokines and is implicated in autoimmune disorders and bacterial infections[1]. IL-17C Protein, Human (HEK293, His) is a recombinant human IL-17C protein with His tag at the C-terminus and is expressed in HEK293 cells.

Background

Interleukin-17C (IL-17C) belongs to the IL-17 cytokine family. IL-17C is predominantly expressed by epithelial cells.
Human and mouse IL-17C shares 76.68% sequence identity.
IL-17C binds to its functional receptor, a heterodimer formed by IL-17RA and IL-17RE. TLR2, TLR3 and TLR5 upregulate the expression of IL-17C at mucosal surfaces. The expression of IL-17C is also regulated by cytokines (TNF-α, IL-1β and IL-17A). IL-17C is an early response cytokine in the defense against bacterial pathogens and upregulates the expression of a variety of antimicrobial peptides including human beta-defensin 2 (hBD2), Lipocalin 2 (LCN2), and granzyme B. IL-17C also stimulates the release of cytokines (IL-1β, TNF-α, and IL-6).
IL-17C is implicated in autoimmune disorders and bacterial infections[1].

In Vitro

IL-17C is abundantly expressed in inflamed skin[2].
IL-17C (100 ng/mL; 16 h) potentiates TNF-α effects and mediates immune cell recruitment by induction of chemokines in keratinocytes[2].
IL-17C (200 ng/mL; 24 h) and TNF-α (2 ng/mL) induce characteristic psoriasis-related transcriptome genes in both additive and synergistic manners. IL-17C (6 h) increases mRNA expression of TNF-α and IL-6[3].

Biological Activity

Immobilized IL-17C Protein, Human (HEK293, His) at 10 μg/mL (100 μl/well) can bind Recombinant Human IL-17RE (C-Fc) . The ED50 of Recombinant Human IL-17RE (C-Fc) is ≤10 ng/mL.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9P0M4 (H19-V197)

Gene ID
Molecular Construction
N-term
IL-17C (H19-V197)
Accession # Q9P0M4
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
CX2; Cytokine CX2; IL17C; Interleukin-17C
AA Sequence

HHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV

Predicted Molecular Mass
20.6 kDa
Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM NaAc, 50 mM NaCl, 6% Trehalose, 2%Mannitol, 0.05% Tween 80, pH 5.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-17C Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-17C Protein, Human (HEK293, His)
Cat. No.:
HY-P72587
Quantity:
MCE Japan Authorized Agent: