1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-17
  5. IL-17A
  6. IL-17A Protein, Canine

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases. IL-17A Protein, Canine is a recombinant canine IL-17A protein and is expressed in E. coli. It consists of 130 amino acids (G26-A155).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Canine is a recombinant canine IL-17A protein and is expressed in E. coli. It consists of 130 amino acids (G26-A155).

Background

Interleukin-17A (IL-17A), also known as CTLA-8, belongs to the IL-17 cytokine family. IL-17A is expressed in memory Th17 cells and is a product of memory CD4+ T cells. IL-17A is also produced by a wide variety of immune cells, including CD8+ T cells, γδT cells, natural killer T (NKT) cells, monocytes, and neutrophils[1][2][3].
The rhesus macaque IL-17A shares 77.78% amino acid sequence identity with human and 63.40% identity with mouse.
IL-17A plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides (defensins and S100 proteins), cytokines (IL-6, G-CSF, and GM-CSF), chemokines (CXCL1, CXCL5, IL-8, CCL2, and CCL7), and matrix metalloproteinases (MMP1, MMP3, and MMP13). IL-17A is detrimental in viral infection through promoting neutrophilic inflammation. IL-17A is a homodimeric cytokine and shares similar biological activities with IL-17F. IL-17A binds to IL-17RA with high affinity, and IL-17RA is required for the biological activity of IL-17A. In tumorigenesis, IL-17A recruits myeloid derived suppressor cells (MDSCs) to dampen anti-tumor immunity. IL-17A also enhances tumor growth in vivo through the induction of IL-6[1][2].
IL-17A can be used for the research of autoimmune diseases, infection and cancer[1][4].

In Vitro

IL-17A can be used as potential biomarkers of motor function recovery in a canine model of spinal cord injury[5].

Biological Activity

Measured by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 1.403 ng/mL, corresponding to a specific activity is 7.13×105 U/mg.

Species

Canine

Source

E. coli

Tag

Tag Free

Accession

C6L8D7 (G26-A155)

Gene ID
Molecular Construction
N-term
IL-17A (G26-A155)
Accession # C6L8D7
C-term
Protein Length

Full Length of Mature Protein

Synonyms
CTLA8; CTLA-8; IL-17; Interleukin-17A; IL17A
AA Sequence

GIAFPQNPGCRNTEDKNFPQHVKVNLNILNRNTNSRRPSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNNEGNINYHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHVA

Molecular Weight

Approximately 16 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-17A Protein, Canine Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-17A Protein, Canine
Cat. No.:
HY-P73170
Quantity:
MCE Japan Authorized Agent: