1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-17
  5. IL-17A IL-17F
  6. IL-17A/F Heterodimer Protein, Human (HEK293, His)

IL-17A/F Heterodimer Protein, Human (HEK293, His)

Cat. No.: HY-P72589
Handling Instructions Technical Support

IL-17A-17F Heterodimer Protein is the heterodimer of the cytokines IL-17A and IL-17F. Both IL-17A and IL-17F can induce antimicrobial peptides, cytokines (IL-6 and GM-CSF), chemokines (CCL2, CCL7 and CXCL1), and matrix metalloproteinases (MMP-1 and MMP13). IL-17A-17F shows intermediate biological activity between IL-17A and IL-17F. IL-17A/F Heterodimer Protein, Human (HEK293, His) is a recombinant human IL-17A-17F heterodimer protein with His tag at the C-terminus and is expressed in HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-17A-17F Heterodimer Protein is the heterodimer of the cytokines IL-17A and IL-17F. Both IL-17A and IL-17F can induce antimicrobial peptides, cytokines (IL-6 and GM-CSF), chemokines (CCL2, CCL7 and CXCL1), and matrix metalloproteinases (MMP-1 and MMP13). IL-17A-17F shows intermediate biological activity between IL-17A and IL-17F[1][2][3][4]. IL-17A/F Heterodimer Protein, Human (HEK293, His) is a recombinant human IL-17A-17F heterodimer protein with His tag at the C-terminus and is expressed in HEK293 cells.

Background

IL-17A-17F Heterodimer Protein is the heterodimer of the cytokines IL-17A and IL-17F. Both IL-17A and IL-17F belongs to the IL-17 cytokine family. IL-17A-17F heterodimer, IL-17A and IL-17F homodimers can be produced by differentiated Th17 cells[1][2]. IL-17F shares the most similarities with IL-17A (50% homology)[2]. Both IL-17A and IL-17F can induces antimicrobial peptides, cytokines (IL-6 and GM-CSF), chemokines (CCL2, CCL7 and CXCL1), and matrix metalloproteinases (MMP-1 and MMP13)[2][3]. IL-17A, IL-17F and IL-17A-17F use the same receptor complex: IL-17RA and IL-17RC heterodimer. And they trigger qualitatively similar signaling pathways. IL-17A-17F shows intermediate biological activity between IL-17A (most potent) and IL-17F (least potent)[2][4].

In Vitro

IL-17F/IL-17A (5 ng/mL; 16-24 h) induces GRO-, IL-6, and IL-8 secretion in human primary foreskin fibroblast (BJ) cells[5].
IL-17F/IL-17A binds to IL-17RA.Fc with an EC50 of 329 ng/mL, IL-17A and IL-17F bind to IL-17RA.Fc with EC50s of 19 ng/mL and > 2000 ng/mL, respectively[5].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q16552 (G24-A155)&AAH70124.1 (R31-Q163)

Gene ID
Synonyms
IL-17A/F Heterodimer; IL-17A&IL-17F Heterodimer
AA Sequence

GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA&RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ

Molecular Weight

15-21 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 1 mM EDTA, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-17A/F Heterodimer Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-17A/F Heterodimer Protein, Human (HEK293, His)
Cat. No.:
HY-P72589
Quantity:
MCE Japan Authorized Agent: