1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. Interleukin & Receptors NK Cell CD Proteins
  4. IL-15 IL-15 Receptor
  5. IL-15R alpha/CD215
  6. IL-15R alpha & IL-15 Protein, Human (HEK293, Fc)

IL-15R alpha & IL-15 Protein, Human (HEK293, Fc)

Cat. No.: HY-P70655
Handling Instructions Technical Support

IL-15R alpha is a high affinity receptor for IL-15 (Kd: 100 pM). IL-15 is essential for the development and function natural killer (NK) cell, NKT cell and memory (m) CD8+ T cell. IL-15R alpha maintains memory CD8+ T cell homeostasis and lymphocyte development. IL-15R alpha/IL-15 complex can activate the antitumor functions of NK cells and CD8+ T cells. IL-15R alpha & IL-15 Protein, Human (HEK293, Fc) is a recombinant human IL-15R alpha (I31-D96) & IL-15 (N49-S162) fusion protein with a C-Terminal hFc tag, which is produced in HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-15R alpha is a high affinity receptor for IL-15 (Kd: 100 pM). IL-15 is essential for the development and function natural killer (NK) cell, NKT cell and memory (m) CD8+ T cell[1]. IL-15R alpha maintains memory CD8+ T cell homeostasis and lymphocyte development. IL-15R alpha/IL-15 complex can activate the antitumor functions of NK cells and CD8+ T cells[2][3]. IL-15R alpha & IL-15 Protein, Human (HEK293, Fc) is a recombinant human IL-15R alpha (I31-D96) & IL-15 (N49-S162) fusion protein with a C-Terminal hFc tag, which is produced in HEK293 cells.

Background

IL-15R alpha is expressed on various cell types, including lymphocytes, myeloid cells, nonlymphoid and nonhematopoietic cells[4]. IL-15 is produced in macrophages and dendritic cells[1].
IL-15R alpha is required for transporting of IL-15 from the endoplasmic reticulum to the cell surface to bind with β (CD122) and γ (CD132) chains on responding lymphocytes[4][5]. When binding with IL-15, the complex increases the in vivo half-life of IL-15 and enhances binding affinity of IL-15 with IL-15Rβ/γ in NK cells and CD8+ T cells. Thus, the signal transmission improves proliferation and antitumor activities of NK cells and CD8+ T cells[2].
IL-15R alpha forms complex with IL-15 and activates the antitumor functions of NK cells and CD8+ T cells. IL-15R alpha/IL-15 complex is a potential immunotherapeutic agent for cancer and viral infection[1].

In Vivo

IL-15R alpha (mouse, pre-complexed with hIL-15, i.p., 15 μg, 200 μL) significantly reduces the tumor volume, and induces an early increase of activated NK cells in B16-F10 melanoma mice[6].
IL-15R alpha & IL-15 Fusion Protein (mouse, i.p., 15 μg & 2.5 μg, 200 μL) causes naive CD8 T cell activation and development into effector cells and long-term memory T cells[7].

Biological Activity

1.The cell proliferation assay using CTLL-2 mouse cytotoxic T cells has an ED50 value of 5-20 ng/mL.
2. Measured in a cell proliferation assay using NK92 cells. The EDED50 for this effect is <0.5 ng/mL, corresponding to a specific activity is >2×106 units/mg.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q13261-1 (I31-D96)&P40933-1 (N49-S162, N120D)

Gene ID

3601  [NCBI]&3600  [NCBI]

Synonyms
IL15RA& IL15; Interleukin-15; IL-15; IL15; IL-15 receptor subunit alpha; IL-15RA; IL-15R-alpha; interleukin-15 receptor subunit alpha
AA Sequence

ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRD&NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANDSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Molecular Weight

Approximately 50-75 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 8% Trehalose, 4% Mannitol, 0.02% Tween80 (w/v), pH 7.5. or 20 mM PB, 150 mM NaCl, pH 7.4 or 20 mM PB, pH 7.4, 8% trehalose, 8% mannitol and 0.02% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-15R alpha & IL-15 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P70655
Quantity:
MCE Japan Authorized Agent: