IL-15 Protein, Rat

IL-15 Protein, Rat is the recombinant rat-derived IL-15 protein, expressed by E. coli, with tag free tag.

IL-15 Protein is a crucial cytokine in the immune system that plays a vital role in promoting both inflammatory and protective immune responses against microbial invaders and parasites. It exerts its effects by modulating various immune cells of the innate and adaptive immune systems. IL-15 stimulates the proliferation of natural killer cells, T-cells, and B-cells, while also facilitating the secretion of multiple cytokines. In monocytes, IL-15 induces the production of IL8 and monocyte chemotactic protein 1/CCL2, which are chemokines responsible for attracting neutrophils and monocytes to sites of infection. Unlike most cytokines, IL-15 is expressed on the surface of IL-15-producing cells in association with its high affinity IL15RA. This allows IL-15 to deliver signals to target cells expressing IL2RB and IL2RG receptor subunits. Upon binding, IL-15 triggers the phosphorylation of JAK1 and JAK3, leading to the recruitment and subsequent phosphorylation of signal transducer and activator of transcription-3/STAT3 and STAT5. Furthermore, IL-15 rapidly phosphorylates STAT6 in mast cells, thereby regulating mast cell survival and the release of cytokines like IL4.

Rat

E. coli

Tag Free

P97604-1 (N49-S162) with an N-terminal M

25670

MNWIDVRYDLEKIESLIQFIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVIESGCKECEELEERNFTEFLQSFIHIVQMFINTS

Greater than 98% as determined by reducing SDS-PAGE. Greater than 98% as determined by SEC-HPLC.

<1 EU/μg, determined by LAL method.