1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-12
  5. IL-12 Protein, Rat (HEK293, His)

IL-12 protein forms IL-12 cytokine and IL-35 cytokine. It regulates T cell and natural killer cell responses, stimulates interferon gamma production, and promotes T helper 1 cell differentiation. IL-12 Protein, Rat (HEK293, His) is a recombinant protein dimer complex containing rat-derived IL-12 protein, expressed by HEK293 , with C-6*His labeled tag. IL-12 Protein, Rat (HEK293, His), has molecular weight of 25-35 & 40-50 kDa, respectively.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-12 protein forms IL-12 cytokine and IL-35 cytokine. It regulates T cell and natural killer cell responses, stimulates interferon gamma production, and promotes T helper 1 cell differentiation. IL-12 Protein, Rat (HEK293, His) is a recombinant protein dimer complex containing rat-derived IL-12 protein, expressed by HEK293 , with C-6*His labeled tag. IL-12 Protein, Rat (HEK293, His), has molecular weight of 25-35 & 40-50 kDa, respectively.

Background

The IL-12 Protein has the ability to heterodimerize with IL12B to form the IL-12 cytokine, or with EBI3/IL27B to form the IL-35 cytokine. It is primarily produced by professional antigen-presenting cells such as B-cells, dendritic cells, macrophages, and granulocytes, and plays a crucial role in regulating T-cell and natural killer-cell responses. IL-12 stimulates the production of interferon-gamma and promotes the differentiation of T-helper 1 cells, bridging the gap between innate resistance and adaptive immunity. Its biological effects are mediated through a receptor composed of IL12R1 and IL12R2 subunits, leading to the phosphorylation of cellular substrates including TYK2 and JAK2. This, in turn, activates STAT4 and facilitates the regulation of cytokine/growth factor responsive genes. In the context of IL-35, IL-12 Protein contributes to maintaining immune homeostasis in the liver microenvironment and acts as an immune-suppressive cytokine. Its signaling occurs through unconventional receptors composed of IL12RB2 and gp130/IL6ST heterodimers or homodimers, and requires the involvement of transcription factors STAT1 and STAT4. Furthermore, IL-12 Protein can form a disulfide-linked heterodimer with IL12B, known as interleukin IL-12, and a non-disulfide-linked heterodimer with EBI3/IL27B, known as interleukin IL-35. Additionally, it interacts with NBR1, promoting the secretion of IL-12.

Biological Activity

Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED50 for this effect is 0.4193 μg/mL, corresponding to a specific activity is 2384.927 units/mg.

  • Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED50 for this effect is 0.4193 μg/mL. corresponding to a specific activity is 2384.927 units/mg.
Species

Rat

Source

HEK293

Tag

C-6*His

Accession

Q9R103 (R23-S215)&Q9R278 (M23-S335)

Gene ID
Molecular Construction
N-term
IL12B (M23-S335)
Accession # Q9R278
C-term
N-term
IL12A (R23-S215)
Accession # Q9R103
6*His
C-term
Synonyms
Interleukin-12; IL-12
AA Sequence

MWELEKDVYVVEVDWRPDAPGETVTLTCDSPEEDDITWTSDQRRGVIGSGKTLTITVREFLDAGQYTCHRGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGRASLSAEKVTLNQRDYEKYSVACQEDVTCPTAEETLPIELVVEAQQQNKYENYSTSFFIRDIIKPDPPKNLQVKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKTKETEEECNQKGAFLVEKTSAEVQCKGANICVQAQDRYYNSSCSKWTCVPCRGRS&RVIPVSGPAKCLNQSQNLLKTTDDMVRTAREKLKHYSCTAGDIDHEDITRDKTSTLEACLPLELHKNESCLATKETSSIIRGSCLPPQKTSLMMTLCLGSIYEDLKMYQSEFQAINAALQSHNHQQITLDRNMLMAIDELMRSLNHSGETLHQKAPMGEADPYRVKMKLCILLHAFSTRVMTINRVMNYLSSS

Molecular Weight

25-35&40-50 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-12 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-12 Protein, Rat (HEK293, His)
Cat. No.:
HY-P72598
Quantity:
MCE Japan Authorized Agent: