1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-11
  5. IL-11 Protein, Mouse (HEK293, Fc)

IL-11 protein is a multifunctional cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation to increase platelet production. It also contributes to liver cell proliferation in response to liver injury. IL-11 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-11 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-11 protein is a multifunctional cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation to increase platelet production. It also contributes to liver cell proliferation in response to liver injury. IL-11 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-11 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The IL-11 Protein emerges as a versatile cytokine with multifaceted roles, stimulating the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells while inducing megakaryocyte maturation, leading to heightened platelet production. Additionally, IL-11 contributes to hepatocyte proliferation in response to liver damage. Upon binding to its receptor, formed by IL6ST and either IL11RA1 or IL11RA2, IL-11 activates a signaling cascade promoting cell proliferation, a process implicated in various cancers. This signaling triggers the activation of intracellular protein kinases and the phosphorylation of STAT3. Notably, the interaction with membrane-bound IL11RA and IL6ST leads to 'classic signaling,' while the binding of soluble IL11RA to IL6ST stimulates 'trans-signaling.' IL-11 further forms a multimeric signaling complex by interacting with either IL11RA1 or IL11RA2, highlighting its pivotal role in orchestrating diverse cellular responses.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-11 R alpha at 5 μg/mL(100 μL/well) can Mouse IL-11 Protein. The ED50 for this effect is 5.523 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-11 R alpha at 5μg/mL(100 μL/well) can Mouse IL-11 Protein. The ED50 for this effect is 5.523 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

P47873 (P22-L199)

Gene ID
Molecular Construction
N-term
IL-11 (P22-L199)
Accession # P47873
hFc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rMuInterleukin-11/IL-11, Fc ; Interleukin-11; Il11; IL-11
AA Sequence

PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Molecular Weight

50-60 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 10 mMHAc-NaAc, 150 mM NaCl, 0.004% Tween80, 5% Mannitol, pH 4.0 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-11 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-11 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P70356
Quantity:
MCE Japan Authorized Agent: