1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-11
  5. IL-11 Protein, Human (CHO)

IL-11 Protein, Human (CHO) is a CHO cell derived protective factor, which has a protective role and can accelerate recovery of platelets, and remarkably lessen the extent of inflammatory responses.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE IL-11 Protein, Human (CHO)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-11 Protein, Human (CHO) is a CHO cell derived protective factor, which has a protective role and can accelerate recovery of platelets, and remarkably lessen the extent of inflammatory responses.

Background

Recombinant Human Interleukin-11 (IL-11) plays a very crucial role in inflammation. Being an essential cytokine, IL-11 promotes chronic gastric inflammation and also associated with STAT3 and STAT1 mediated tumorigenesis. In addition, IL-11 is also an indispensable factor in IL-13- induced Th2-mediated inflammatory disorders and tissue remodeling. IL-11 has diverse biological functions. It has a protective role against neutron radiation injury, capable of promoting a faster recovery of small intestine injuries and also functions in response to inflammation in animal models of infection. Studies have revealed that IL-11 protects animal models of sepsis from liver injuries. Although its role in platelet production in neonates remains unclear, IL-11 is reported to be involved in the endogenous cytokine response to sepsis or Necrotizing Enterocolitis (NEC) in premmies. IL-11 is also involved in NF-κB signaling pathway and inhibition of IL-6 can reduce colitis associated tumorigenesis [1]. Recombinant human interleukin-11 directly promotes megakaryocytopoiesis in vitro[2].

Biological Activity

The ED50 is <5 ng/mL as measured in a proliferation assay by TF-1 cells.

Species

Human

Source

CHO

Tag

Tag Free

Accession

P20809-1 (P22-L199)

Gene ID
Molecular Construction
N-term
IL-11 (P22-L199)
Accession # P289-1
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
rHuIL-11; Adipogenesis inhibitory factor; AGIF
AA Sequence

PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Molecular Weight

Approximately 23 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-11 Protein, Human (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-11 Protein, Human (CHO)
Cat. No.:
HY-P7031A
Quantity:
MCE Japan Authorized Agent: