IL-10 Protein, Canine

IL-10 is the most important cytokine that inhibits pro-inflammatory responses and limits excessive immune responses in various autoimmune diseases. It belongs to the type 2 cytokine superfamily. IL-10 plays an important role in transmitting information, activating and regulating immune cells, mediating T and B cell activation, proliferation and differentiation, and in inflammatory responses. IL-10 can promote the proliferation and activation of CD8T⁺ cells, enhancing anti-tumor capabilities. IL-10 Protein, Canine is the recombinant canine-derived IL-10 protein, expressed by E. coli , with tag free.

IL-10 is the most important cytokine that inhibits pro-inflammatory responses and limits excessive immune reactions in various autoimmune diseases. IL-10 plays a crucial role in delivering messages, activating and regulating immune cells, mediating T and B cell activation, proliferation and differentiation, and in inflammatory responses. IL-10 can suppress the production of cytokines by TH1 cells and antigen-presenting cells (macrophages and dendritic cells). Additionally, IL-10 not only directly inhibits pro-inflammatory TH17 cells, but also has a direct effect on CD4⁺Foxp3⁺ regulatory T cells (Tregs) and promotes their suppressive function. When IL-10 binds to its receptor complex, JAK1 (located on the IL-10Rα chain) and Tyk2 (located on the IL-10Rβ chain) are activated. This further leads to the phosphorylation of STAT3 and the expression of downstream genes such as SOCS-1 and SOCS-3. IL-10 can downregulate the expression of major histocompatibility complex II on monocytes, reducing their antigen-presenting function. It can also downregulate T lymphocyte activity, inhibit the activation, migration, and adhesion of inflammatory cells. At the same time, IL-10 can suppress the synthesis and release of inflammatory cytokines. IL-10 can promote the proliferation and activation of CD8T⁺ cells, enhancing their anti-tumor capacity^[1].

Measured in a cell proliferation assay using HepG2. The ED₅₀ for this effect is 3.15 ng/mL. corresponding to a specific activity is 3.17×10⁵ units/mg.

• 
  Measured in a cell proliferation assay using HepG2. The ED₅₀ for this effect is 3.15 ng/mL. corresponding to a specific activity is 3.17×10⁵ units/mg.

Canine

E. coli

Tag Free

XP_855560 (S20-I179)

403628  [NCBI]

SRHQSTLPEDDCTHFPASLPHMLRELRAAFGRVKTFFQMKDKLDNILLTGSLLEDFKSYLGCQALSEMIQFYLEEVMPRAENHDPDIKNHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEQVKSAFSKLQEKGVYKAMSEFDIFINYIETYMTMRMKI

Approximately 18.9 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 10 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.