IL-1 beta Protein, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag.

IL-1 beta Protein is a potent pro-inflammatory cytokine initially discovered as a major endogenous pyrogen. It induces prostaglandin synthesis, neutrophil activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. IL-1 beta Protein also promotes Th17 differentiation of T-cells and synergizes with IL12 to induce IFNG synthesis from Th1 cells. Additionally, it plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6. IL-1 beta Protein is involved in the transduction of inflammation downstream of pyroptosis, where its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore. It exists as a monomer and interacts with MEFV.

Measured in a proliferation assay using CTLL-2 Mouse Embryonic Fibroblasts Cells. The ED₅₀ for this effect is 6.864 pg/mL, corresponding to a specific activity is 1.46×10⁸ units/mg.

• 
  Measured in a proliferation assay using CTLL-2 Mouse Embryonic Fibroblasts Cells. The ED₅₀ for this effect is 6.864 pg/mL, corresponding to a specific activity is 1.46×10⁸ units/mg.

Canine

E. coli

Tag Free

Q28292 (A115-S266)

403974

Full Length of Mature Protein

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 300 mM NaCl, pH 6.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.