1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors Neurotrophic Factors
  4. IL-1
  5. IL-1 alpha
  6. IL-1 alpha Protein, Rhesus macaque

IL-1 alpha, a cytokine present in non-hematopoietic cells, links innate and adaptive immunity. Binding to its receptor IL1R1, IL-1 alpha forms a receptor complex, activating signaling pathways involving MYD88, IRAK1, and IRAK4. It activates NF-kappa-B and MAPK pathways. Released during cell death, IL-1 alpha induces inflammation, senses DNA damage, and interacts with TMED10, IL1R1, and S100A13 for secretion and plasma membrane translocation. IL-1 alpha Protein, Rhesus macaque is the recombinant Rhesus Macaque-derived IL-1 alpha protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-1 alpha, a cytokine present in non-hematopoietic cells, links innate and adaptive immunity. Binding to its receptor IL1R1, IL-1 alpha forms a receptor complex, activating signaling pathways involving MYD88, IRAK1, and IRAK4. It activates NF-kappa-B and MAPK pathways. Released during cell death, IL-1 alpha induces inflammation, senses DNA damage, and interacts with TMED10, IL1R1, and S100A13 for secretion and plasma membrane translocation. IL-1 alpha Protein, Rhesus macaque is the recombinant Rhesus Macaque-derived IL-1 alpha protein, expressed by E. coli , with tag free.

Background

The IL-1 alpha protein, a cytokine intrinsically present in almost all quiescent non-hematopoietic cells, plays a pivotal role in inflammation, serving as a crucial link between the innate and adaptive immune systems. Upon binding to its receptor IL1R1, alongside its accessory protein IL1RAP, IL-1 alpha forms the high-affinity interleukin-1 receptor complex, initiating signaling pathways that involve the recruitment of adapter molecules such as MYD88, IRAK1, or IRAK4. This, in turn, activates NF-kappa-B and three MAPK pathways—p38, p42/p44, and JNK pathways. Internally, IL-1 alpha acts as an alarmin, being released into the extracellular space after cell membrane disruption during cell death, thereby inducing inflammation and signaling the host to injury or damage. Beyond its role as a danger signal released during cell necrosis, IL-1 alpha directly senses DNA damage and functions as a signal for genotoxic stress without compromising cell integrity. As a monomer, IL-1 alpha interacts with TMED10, facilitating its translocation from the cytoplasm to the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) for secretion. Additionally, it interacts with IL1R1 and S100A13, the latter being the initial step in IL-1 alpha export, followed by the direct translocation of this complex across the plasma membrane.

Biological Activity

1.Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 10 pg/mL, corresponding to a specific activity of >1.0x108 IU/mg.
2.Measured in a cell proliferation assay using CTLL-2 cells. The ED50 for this effect is 19.28 pg/mL, corresponding to a specific activity is 5.187×107 U/mg.

Species

Rhesus Macaque

Source

E. coli

Tag

Tag Free

Accession

P48089 (S113-A271)

Gene ID
Molecular Construction
N-term
IL-1α (S113-A271)
Accession # P48089
C-term
Synonyms
IL1A; Interleukin-1 alpha; IL-1 alpha; Hematopoietin-1
AA Sequence

SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEINKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA

Molecular Weight

Approximately 18.1 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-1 alpha Protein, Rhesus macaque
Cat. No.:
HY-P71866
Quantity:
MCE Japan Authorized Agent: