1. Recombinant Proteins
  2. Others
  3. IL-1 alpha/IL-1F1 Protein, Pig

The IL-1α/IL-1F1 protein is found intracellularly in most non-hematopoietic cells and plays a crucial role in mediating inflammation and linking innate and adaptive immunity. IL1RAP binds to IL1R1 to form a high-affinity receptor complex that activates cascades and pathways.IL-1 alpha/IL-1F1 Protein, Pig is the recombinant Porcine-derived IL-1 alpha/IL-1F1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IL-1α/IL-1F1 protein is found intracellularly in most non-hematopoietic cells and plays a crucial role in mediating inflammation and linking innate and adaptive immunity. IL1RAP binds to IL1R1 to form a high-affinity receptor complex that activates cascades and pathways.IL-1 alpha/IL-1F1 Protein, Pig is the recombinant Porcine-derived IL-1 alpha/IL-1F1 protein, expressed by E. coli , with tag free.

Background

The cytokine interleukin-1 alpha (IL-1 alpha), constitutively present intracellularly in almost all quiescent non-hematopoietic cells, plays a crucial role in inflammation and serves as a key mediator bridging the innate and adaptive immune systems. Upon binding to its receptor IL1R1, along with its accessory protein IL1RAP, IL-1 alpha forms the high-affinity interleukin-1 receptor complex, initiating signaling cascades involving the recruitment of adapter molecules such as MYD88, IRAK1, or IRAK4. This activation leads to the subsequent activation of NF-kappa-B and the three MAPK pathways—p38, p42/p44, and JNK pathways. Intracellularly, IL-1 alpha acts as an alarmin, and its release into the extracellular space upon cell death, following cell membrane disruption, induces inflammation and signals the host response to injury or damage. In addition to its role as a danger signal during cell necrosis, IL-1 alpha directly senses DNA damage, serving as a signal for genotoxic stress without compromising cell integrity. As a monomer, IL-1 alpha interacts with TMED10, facilitating translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and subsequent secretion. Furthermore, IL-1 alpha interacts with IL1R1 and S100A13, with the latter interaction being the initial step in the export of IL-1 alpha, followed by the direct translocation of this complex across the plasma membrane.

Biological Activity

1.Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is 10-60 pg/mL.
2.Measured in a cell proliferation assay using CTTL2 cells. The ED50 for this effect is 6.554 pg/mL, corresponding to a specific activity is 1.526×108 units/mg.

Species

Porcine

Source

E. coli

Tag

Tag Free

Accession

P18430 (Q119-S270)

Gene ID
Protein Length

Partial

Synonyms
Interleukin-1 alpha; IL1A; IL-1 alpha; Interleukin 1 alpha
AA Sequence

QSNMKYNFMRVINHQCILNDARNQSIIRDPSGQYLMAAVLNNLDEAVKFDMAAYTSNDDSQLPVTLRISETRLFVSAQNEDEPVLLKELPETPKTIKDETSLLFFWEKHGNMDYFKSAAHPKLFIATRQEKLVHMAPGLPSVTDFQILENQS

Molecular Weight

Approximately 17.5 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS and DTT with BSA as a carrier protein.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-1 alpha/IL-1F1 Protein, Pig Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-1 alpha/IL-1F1 Protein, Pig
Cat. No.:
HY-P79243
Quantity:
MCE Japan Authorized Agent: