1. Recombinant Proteins
  2. Fc Receptors
  3. Immunoglobulin Fc Region
  4. IgG1
  5. IgG1 Protein, Mouse (HEK293)

The immunoglobulin heavy chain constant region is the heavy chain constant region of immunoglobulin. Sequence differences between immunoglobulin heavy chains leads to the various isotypes with different characteristic. IgG1 Protein, Mouse (HEK293) is the recombinant mouse-derived IgG1 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The immunoglobulin heavy chain constant region is the heavy chain constant region of immunoglobulin. Sequence differences between immunoglobulin heavy chains leads to the various isotypes with different characteristic[1][2]. IgG1 Protein, Mouse (HEK293) is the recombinant mouse-derived IgG1 protein, expressed by HEK293 , with tag free.

Background

The immunoglobulin heavy chain constant region is the heavy chain constant region of immunoglobulin. Sequence differences between immunoglobulin heavy chains leads to the various isotypes with different characteristic. The immunoglobulin heavy chain constant region affects kinetic and Tthermodynamic parameters of antibody variable region interactions with antigen[1][2].

Species

Mouse

Source

HEK293

Tag

Tag Free

Accession

AAK53870.1 (P99-K324)

Gene ID

/

Molecular Construction
N-term
IgG1 (P99-K324)
Accession # AAK53870.1
C-term
Protein Length

Partial

Synonyms
Ig gamma-1 chain C region; IGHG1
AA Sequence

PRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK

Molecular Weight

Approximately 30-33 kDa

Purity

Greater than 85% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IgG1 Protein, Mouse (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IgG1 Protein, Mouse (HEK293)
Cat. No.:
HY-P70763
Quantity:
MCE Japan Authorized Agent: