1. Recombinant Proteins
  2. Receptor Proteins
  3. IGFLR1 Protein, Human (HEK293, C-His)

IGFLR1 protein, a probable cell membrane receptor, exhibits specific affinity for IGF-like family proteins IGFL1 and IGFL3, with higher binding affinity compared to others. This selective interaction profile suggests a key role for IGFLR1 in mediating cellular responses to these ligands, emphasizing its significance in the intricate network of cellular signaling pathways. IGFLR1 Protein, Human (HEK293, C-His) is the recombinant human-derived IGFLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IGFLR1 protein, a probable cell membrane receptor, exhibits specific affinity for IGF-like family proteins IGFL1 and IGFL3, with higher binding affinity compared to others. This selective interaction profile suggests a key role for IGFLR1 in mediating cellular responses to these ligands, emphasizing its significance in the intricate network of cellular signaling pathways. IGFLR1 Protein, Human (HEK293, C-His) is the recombinant human-derived IGFLR1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The IGFLR1 protein emerges as a probable cell membrane receptor for the IGF-like family proteins, demonstrating a specific affinity for IGFL1 and IGFL3, with a higher binding affinity compared to other family members. This suggests a selective interaction profile between IGFLR1 and these ligands. Furthermore, IGFLR1 may also exhibit the capacity to bind IGFL2, further expanding its potential ligand repertoire. The distinctive binding preferences underscore the receptor's role in mediating cellular responses to IGF-like family proteins, highlighting its significance in the intricate network of cellular signaling pathways.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9H665-1 (S23-P163)

Gene ID
Molecular Construction
N-term
IGFLR1 (S23-P163)
Accession # Q9H665-1
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
IGFLR1; IGF-like family receptor 1; TMEM149, transmembrane protein 149 , U2(RNU2) small nuclear RNA auxiliary factor 1 like 4 , U2AF1L4; FLJ22573; transmembrane protein 149; U2 small nuclear RNA auxiliary factor 1-like 4; U2(RNU2) small nuclear RNA auxiliary factor 1-like 4; TMEM149; U2AF1L4;
AA Sequence

SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP

Predicted Molecular Mass
17.4 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

IGFLR1 Protein, Human (HEK293, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IGFLR1 Protein, Human (HEK293, C-His)
Cat. No.:
HY-P700454
Quantity:
MCE Japan Authorized Agent: