1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. IGF family
  4. IGFBP-7
  5. IGFBP-7 Protein, Mouse (HEK293, His)

The IGFBP-7 protein has moderate affinity to bind to IGF-I and IGF-II and significantly stimulates the production of prostacyclin (PGI2). In addition to its interaction with insulin-like growth factors, IGFBP-7 also contributes to cell adhesion, suggesting its role in adhesion-related cellular processes and potential effects on cell-matrix interactions. IGFBP-7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IGFBP-7 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IGFBP-7 protein has moderate affinity to bind to IGF-I and IGF-II and significantly stimulates the production of prostacyclin (PGI2). In addition to its interaction with insulin-like growth factors, IGFBP-7 also contributes to cell adhesion, suggesting its role in adhesion-related cellular processes and potential effects on cell-matrix interactions. IGFBP-7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IGFBP-7 protein, expressed by HEK293 , with C-His labeled tag.

Background

The IGFBP-7 Protein exhibits the ability to bind to IGF-I and IGF-II, albeit with relatively low affinity, while also demonstrating the capacity to stimulate prostacyclin (PGI2) production. In addition to its interaction with insulin-like growth factors, IGFBP-7 plays a role in promoting cell adhesion, suggesting its involvement in cellular processes related to adhesion and potentially influencing cell-matrix interactions. These functional characteristics underscore the diverse roles of IGFBP-7 in modulating growth factor signaling and cellular responses.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q61581 (S26-L281)

Gene ID
Molecular Construction
N-term
IGFBP-7 (S26-L281)
Accession # Q61581
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Insulin-like growth factor-binding protein 7; IGFBP7; IGF-binding protein 7; IGFBP-rP1; MAC25 protein; Tumor-derived adhesion factor; TAF
AA Sequence

SSSDACGPCVPASCPALPRLGCPLGETRDACGCCPVCARGEGEPCGGGAAGRGHCAPGMECVKSRKRRKGKAGAAAGGPATLAVCVCKSRYPVCGSNGITYPSGCQLRAASLRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAKVFLSCEVIGIPTPVLIWNKVKRDHSGVQRTELLPGDRENLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASAAAKITVVDALHEIPLKKGEGAQL

Molecular Weight

32-38 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

IGFBP-7 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IGFBP-7 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70858
Quantity:
MCE Japan Authorized Agent: