1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. IGF family
  4. Insulin-like Growth Factor I (IGF-1)
  5. IGF-I Protein, Salmon

IGF-I protein is similar to insulin and exerts effective growth-promoting activity as a ligand of IGF1R. Binding to the α subunit of IGF1R activates intrinsic tyrosine kinase, triggering autophosphorylation of the β subunit. IGF-I Protein, Salmon is the recombinant IGF-I protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IGF-I protein is similar to insulin and exerts effective growth-promoting activity as a ligand of IGF1R. Binding to the α subunit of IGF1R activates intrinsic tyrosine kinase, triggering autophosphorylation of the β subunit. IGF-I Protein, Salmon is the recombinant IGF-I protein, expressed by E. coli , with tag free.

Background

The IGF-I protein, structurally and functionally related to insulin, exhibits significantly higher growth-promoting activity. Serving as a ligand for IGF1R, it binds to the alpha subunit of IGF1R, triggering the activation of the intrinsic tyrosine kinase activity. This activation leads to the autophosphorylation of tyrosine residues in the beta subunit, initiating a cascade of downstream signaling events that activate the PI3K-AKT/PKB and Ras-MAPK pathways. IGF-I also binds to integrins, forming a ternary complex with integrins and IGFR1, which proves essential for IGF1 signaling. This intricate molecular interaction highlights the multifaceted role of IGF-I in mediating cellular responses and growth-promoting functions.

Biological Activity

Measure by its ability by a dose-response proliferation assay using human FDC-P1 cells. The ED50 for this effect is <15 ng/mL. The specific activity of this protein is > 6.7 × 104 IU/mg. (It is recommended to experimentally determine the optimal concentration for each specific application by performing a dose response assay.)

Species

Others

Source

E. coli

Tag

Tag Free

Accession

Q02815 (G45-A114)

Gene ID

100136741

Molecular Construction
N-term
IGF-I (G45-A114)
Accession # Q02815
C-term
Protein Length

Full Length of Mature Protein

Synonyms
IGF1; IGF-1; insulin-like growth factor 1; Insulin-like growth factor I; Somatomedin C; somatomedin-C
AA Sequence

GPETLCGAELVDTLQFVCGERGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKSGKAA

Molecular Weight

Approximately 8 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

< 0.2 EU/μg of protein by gel clotting method

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IGF-I Protein, Salmon Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IGF-I Protein, Salmon
Cat. No.:
HY-P701241
Quantity:
MCE Japan Authorized Agent: