1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-γ
  5. IFN-gamma Protein, Mouse

IFN-gamma Protein is a cytokine belonging to the interferon family, secreted by activated immune cells such as T cells and NK cells. IFN-gamma Protein plays a key role in the immune system, exerting activities including regulating immune responses, antiviral effects, and antitumor effects. IFN-gamma Protein, Mouse is a recombinant IFN-gamma protein expressed by E. coli without any tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-gamma Protein is a cytokine belonging to the interferon family, secreted by activated immune cells such as T cells and NK cells. IFN-gamma Protein plays a key role in the immune system, exerting activities including regulating immune responses, antiviral effects, and antitumor effects. IFN-gamma Protein, Mouse is a recombinant IFN-gamma protein expressed by E. coli without any tag[1][2][3][4].

Background

IFN-gamma is a cytokine with immunomodulatory, antitumor, and antiviral properties. IFN-gamma can activate macrophages and NK cells, regulate T-cell differentiation, and participate in inflammatory responses. IFN-gamma induces antiviral proteins to inhibit viral replication and enhances the immune recognition of infected cells. IFN-gamma also exerts antitumor effects by suppressing tumor cell proliferation, activating immune cells, and inhibiting tumor angiogenesis. Meanwhile, IFN-gamma promotes the expression of MHC molecules to improve the efficiency of immune cells in recognizing pathogens and abnormal cells. Additionally, IFN-gamma is involved in regulating the differentiation and maturation of bone marrow hematopoietic stem cells[1][2][3][4].

In Vitro

IFN-gamma Protein (Mouse; 10 ng/mL; 24 h) can upregulate the expression of MHC-I and PD-L1 in tumor cell line MC38, and the effect is better when used in combination with Nintedanib (HY-50904)[5].

In Vivo

IFN-gamma Protein (Mouse; 10 ng; intranasal administration; on days 1, 3, and 5 post-infection) after primary respiratory syncytial virus (RSV) infection in mice significantly alleviates airway hyperresponsiveness (AHR) and inflammation upon reinfection[6].
IFN-gamma Protein (Mouse; 50,000 U/animal; intravenous injection; 3 times/week; 4 weeks) exhibits antitumor activity and reduces the number of lung metastatic foci in a mouse melanoma tumor model[7].

Biological Activity

1. Determined by its ability to inhibit the proliferation of murine WEHI-279 cells. The expected ED50 is < 1 ng/mL.
2. Measured by its ability to inhibit the proliferation of HT-29 human coloncancer cells. The ED50 for this effect is ≤0.7283 ng/mL, corresponding to a specific activity is ≥1.37×106 Unit/mg.
3.Measured by its binding ability in a functional ELISA. When Recombinant Mouse IFN gamma is used at 10 μg/mL, the concentration of Recombinant Mouse CD119. The ED50 for this effect is <150 ng/mL.

  • Measured by its ability to inhibit the proliferation of HT-29 human colon cancer cells. The ED50 for this effect is 0.1399 ng/mL, corresponding to a specific activity is 7.147×106 Unit/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P01580 (H23-C155)

Gene ID
Molecular Construction
N-term
IFN-gamma (H23-C155)
Accession # P01580
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rMuIFN-γ; IFNG; IFN-gamma; Interferon gamma
AA Sequence

HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

Predicted Molecular Mass
15.5 kDa
Molecular Weight

Approximately 12-15 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS or 4 mM HCl or 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4, 8% trehalose or 4 mM HCl, 4% Mannitol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IFN-gamma Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-gamma Protein, Mouse
Cat. No.:
HY-P7071
Quantity:
MCE Japan Authorized Agent: