1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-γ
  5. IFN-gamma Protein, Mouse (HEK293)

IFN-gamma is a type II interferon family cytokine that participates in antiviral, antibacterial, and antitumor responses. IFN-gamma Protein, Mouse (HEK293) is the recombinant mouse-derived IFN-gamma protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg Get quote
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IFN-gamma is a type II interferon family cytokine that participates in antiviral, antibacterial, and antitumor responses. IFN-gamma Protein, Mouse (HEK293) is the recombinant mouse-derived IFN-gamma protein, expressed by HEK293 , with tag free.

Background

IFN-gamma is produced by immune cells such as T cells and NK cells, and plays a key role in antibacterial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation[1][2][5][6].FN-gamma is involved in the regulation of hematopoietic stem cells under developmental and steady-state conditions by affecting their development, quiescence, and differentiation[3][4].IFN-gamma increases the susceptibility of cancer cells to external and internal apoptosis pathways by regulating the expression of Fas/FasL, TNF-related apoptosis-inducing ligand (TRAIL), caspase-8, -3, -7, and -1, survivin, and Bim[5].IFN-gamma mainly interacts with its receptor IFNGR1 through the JAK-STAT pathway to affect gene regulation. After binding to the receptor, the intracellular domain of IFNGR1 opens, allowing downstream signaling elements JAK2, JAK1, and STAT1 to bind, resulting in STAT1 activation, nuclear translocation, and IFN-gamma-regulated gene transcription[6].IFN-gamma achieves antiviral effects by inducing RNA-activated protein kinase R (PKR) and adenosine deaminase RNA-specific-1 (ADAR-1) to activate antiviral proteins[6].IFN-gamma can inhibit the production of IL-4 by TH1 cells and maintain the sustained expression of T-bet[7].As a central effector of cell-mediated immunity, IFN-gamma can enhance antigen recognition through interactions with homologous T cells, amplify antigen presentation through antigen-presenting cells (APCs), increase the production of reactive oxygen species (ROS) and reactive nitrogen intermediates (RNIs), and induce antiviral responses[8].

Biological Activity

1. Measured by its ability to inhibit the proliferation of HT-29 human coloncancer cells. The ED50 for this effect is <2 ng/mL.
2. Measured by its ability to inhibit the proliferation of BaF3 cells. The ED50 for this effect is <2 ng/mL.

  • Measured by its ability to inhibit the proliferation of HT-29 human coloncancer cells.The ED50 for this effect is 0.321 ng/mL, corresponding to a specificactivity is 3.11×106 Unit/mg.
Species

Mouse

Source

HEK293

Tag

Tag Free

Accession

P01580 (H23-C155)

Gene ID
Molecular Construction
N-term
IFN-gamma (H23-C155)
Accession # P01580
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Ifng; Interferon gamma; IFN-gamma
AA Sequence

HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC

Predicted Molecular Mass
15.5 kDa
Molecular Weight

Approximately 12-21 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IFN-gamma Protein, Mouse (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-gamma Protein, Mouse (HEK293)
Cat. No.:
HY-P70667
Quantity:
MCE Japan Authorized Agent: