1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-γ
  5. IFN-gamma Protein, Canine

IFN-gamma (interferon-gamma) is a type II interferon produced by immune cells such as T cells and NK cells, and plays a key role in activating antibacterial, antiviral, and antitumor responses. Through the JAK-STAT pathway, its interaction with the receptor IFNGR1 triggers gene regulation. IFN-gamma Protein, Canine is the recombinant canine-derived IFN-gamma protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IFN-gamma (interferon-gamma) is a type II interferon produced by immune cells such as T cells and NK cells, and plays a key role in activating antibacterial, antiviral, and antitumor responses. Through the JAK-STAT pathway, its interaction with the receptor IFNGR1 triggers gene regulation. IFN-gamma Protein, Canine is the recombinant canine-derived IFN-gamma protein, expressed by E. coli , with tag free.

Background

IFN-gamma (Interferon-gamma), a type II interferon produced by immune cells like T-cells and NK cells, plays pivotal roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Its primary signaling pathway involves the JAK-STAT pathway upon interaction with its receptor, IFNGR1, influencing gene regulation. Upon IFN-gamma binding, the IFNGR1 intracellular domain undergoes conformational changes, facilitating the association of downstream signaling components, including JAK2, JAK1, and STAT1. This cascade leads to STAT1 activation, nuclear translocation, and subsequent transcription of IFN-gamma-regulated genes, many of which are transcription factors like IRF1, capable of driving a subsequent wave of transcription. IFN-gamma contributes to the class I antigen presentation pathway by inducing the replacement of catalytic proteasome subunits with immunoproteasome subunits, thereby enhancing the quantity, quality, and repertoire of peptides for class I MHC loading. It also increases the efficiency of peptide generation by inducing the expression of the activator PA28, which associates with the proteasome and alters its proteolytic cleavage preference. Furthermore, IFN-gamma up-regulates MHC II complexes on the cell surface by promoting the expression of key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL. Beyond its direct immune functions, IFN-gamma participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions, influencing their development, quiescence, and differentiation. Existing as a homodimer, IFN-gamma interacts with IFNGR1 via its extracellular domain, a crucial interaction that promotes IFNGR1 dimerization, orchestrating its diverse and critical functions in immune responses and hematopoiesis.

Biological Activity

Measured by its ability to inhibit the proliferation of HT-29 human coloncancer cells. The ED50 for this effect is 0.02271 ng/mL, corresponding to a specific activity is 4.40×10^7 Unit/mg.

  • Measured by its ability to inhibit the proliferation of HT-29 human coloncancer cells. The ED50 for this effect is 0.02271 ng/mL, corresponding to a specific activity is 4.40×107 Unit/mg.
Species

Canine

Source

E. coli

Tag

Tag Free

Accession

P42161 (Q24-K166)

Gene ID
Molecular Construction
N-term
IFN-gamma (Q24-K166)
Accession # P42161
C-term
Synonyms
Interferon gamma; IFN-gamma; IFNG
AA Sequence

QAMFFKEIENLKEYFNASNPDVSDGGSLFVDILKKWREESDKTIIQSQIVSFYLKLFDNFKDNQIIQRSMDTIKEDMLGKFLNSSTSKREDFLKLIQIPVNDLQVQRKAINELIKVMNDLSPRSNLRKRKRSQNLFRGRRASK

Molecular Weight

Approximately 16.25 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IFN-gamma Protein, Canine Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-gamma Protein, Canine
Cat. No.:
HY-P79295
Quantity:
MCE Japan Authorized Agent: