1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-alpha
  5. IFN-alpha 14
  6. IFN-alpha 14/IFNA14 Protein, Human (His-SUMO)

IFN-alpha 14 (IFNA14), belongs to type I interferon family, is produced by macrophages with antiviral activities. IFN-alpha 14/IFNA14 Protein, Human (His-SUMO) contains 166 a.a. (C24-D189), produced in E. coli cells with a N-terminal His-SUMO tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-alpha 14 (IFNA14), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 14/IFNA14 Protein, Human (His-SUMO) contains 166 a.a. (C24-D189), produced in E. coli cells with a N-terminal His-SUMO tag.

Background

IFN-alpha 14 (IFNA14; IFN-α14), belongs to the alpha/beta interferon (IFN) family, is produced by the macrophages with antiviral activities[1]. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively[2].
Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Interferon alpha (IFNa) shows significant biological activity in various cancers, paticularly haematological malignancies such as hairy cell leukaemia and chronic myelogenous leukaemia[3].
IFN-alpha 14 involves in JAK/STAT signaling pathway, is identified as potent regulators that reduces both CTLA4 and FOXP3. Therefore, regulatory T cells (Tregs) as the key cells regulating peripheral autoreactive T lymphocytes, IFNα-14 regulates Treg functional states and destabilises Treg[4].
IFN-alpha14 is a new gene found in tissues of uninfected mice, also found to lack N-glycosylation and have its expression induced in response to viral infection in contrast to IFN-alpha 13[5].

In Vitro

IFN-alpha 14 (10 pM-10 μM; 24-26 h) results signifcant reduction of both CTLA4 and FOXP3 gene expression in regulatory T cells (Tregs) without affecting cell viability[4].

Species

Human

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

P01570 (C24-D189)

Gene ID
Molecular Construction
N-term
6*His-SUMO
IFNA14 (C24-D189)
Accession # P01570
C-term
Protein Length

Full Length of Mature Protein

Synonyms
IFN-alpha14; IFN14_HUMAN; IFNA14; Interferon alpha 14; Interferon alpha H; Interferon alpha-14; Interferon alpha-H; Interferon lambda-2-H; Interferon lambda2H ; LeIF H; LeIFH; MGC125756; MGC125757
AA Sequence

CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD

Molecular Weight

Approximately 35.7 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IFN-alpha 14/IFNA14 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-alpha 14/IFNA14 Protein, Human (His-SUMO)
Cat. No.:
HY-P72243
Quantity:
MCE Japan Authorized Agent: