1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-alpha
  5. IFN-alpha 2a
  6. IFN-alpha 2/IFNA2 Protein, Mouse (HEK293, Fc, solution)

IFN-alpha 2/IFNA2 Protein, Mouse (HEK293, Fc, solution)

Cat. No.: HY-P73248
Handling Instructions Technical Support

IFN-alpha 2 (IFNA2), belongs to type I interferon family, is a protein secreted by cells infected by a virus and acting on other cells to inhibit viral infection. IFN-alpha 2 increases the frequencies of cytotoxic CD8+ T cells and induces CD4+ T cell depletion. IFN-alpha 2/IFNA2 Protein, Mouse (HEK293, Fc) contains 167 a.a. (C24-E190), is produced in HEK293 cells with a N-terminal hFc-tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-alpha 2 (IFNA2), belongs to type I interferon family, is a protein secreted by cells infected by a virus and acting on other cells to inhibit viral infection[1]. IFN-alpha 2 increases the frequencies of cytotoxic CD8+ T cells and induces CD4+ T cell depletion[3]. IFN-alpha 2/IFNA2 Protein, Mouse (HEK293, Fc) contains 167 a.a. (C24-E190), is produced in HEK293 cells with a N-terminal hFc-tag.

Background

IFN-alpha 2 (IFNA2; IFN-α2), belongs to the type I interferon family, produced by the plasmacytoid dendritic cells (pDCs) exposure to HIV-1BaL in order to inhibit viral infection[1].
Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively[2].
IFN-alpha 2 subtype is the only one that is currently licensed to treat infections caused by hepatitis B virus (HBV) and HCV[3].
IFN-alpha 2 shows a Sortilin-dependent trafficking in cells and increases the expression level of interferon-stimulated genes (ISGs) in HIV-infected cells[1][4]. It also exhibits cytotoxic activity against CD8+ T cells and enhances CD4+ T cell depletion[3].
Among the IFN-alpha 2 alleles, IFN-alpha 2b is being the predominant allele while IFNα-2a is less predominant and IFNα-2c only a minor allelic variant[5].
IFN-alpha 2 has a bored application in research of cancer, including some hematological malignancies and solid tumors[6]. As for a wildly use of IFN in animal disease model, the sequence of amino acids in IFNA2a protein of mouse is very different from human (59.57%).

In Vitro

mIFN-alpha 2 (mouse) mediates the interaction with mSortilin via Arg22, and the mIFNa2-mCherry is transiently co-expressed with mSortilin-EGFP in HEK293T cells[4].

Biological Activity

1.Measured in antiviral assays using L929 cells infected with vesicular stomatitisvirus (VSV) and the ED50 is 1-8 ng/mL.
2. Measured by binding ability in a functional ELISA. Immobilized mouse IFNAR1-His at 2 μg/mL (100 μl/well) can bind IFN-alpha 2 Protein, Mouse (HEK293, Fc) and the EC50 is 47.5 ng/mL.

Species

Mouse

Source

HEK293

Tag

N-hFc

Accession

P01573 (C24-E190)

Gene ID
Molecular Construction
N-term
hFc
IFNA2 (C24-E190)
Accession # P01573
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interferon alpha-2; IFN-alpha-2; LeIF A; IFNA2; IFNA2A
AA Sequence

CDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE

Molecular Weight

Approximately 52 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

IFN-alpha 2/IFNA2 Protein, Mouse (HEK293, Fc, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-alpha 2/IFNA2 Protein, Mouse (HEK293, Fc, solution)
Cat. No.:
HY-P73248
Quantity:
MCE Japan Authorized Agent: