1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-alpha
  5. IFN-alpha 13
  6. IFN-alpha 13/IFNA13 Protein, Mouse (HEK293, His)

IFN-alpha 13/IFNA13 Protein, Mouse (HEK293, His)

Cat. No.: HY-P73125
Handling Instructions Technical Support

IFN-alpha 13 (IFNA13), belongs to type I interferon family, is produced by macrophages with antiviral activities. IFN-alpha 13/IFNA13 Protein, Mouse (HEK293, His) contains 189 a.a. (M1-E189), produced in HEK293 cells with a C-terminal His-tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-alpha 13 (IFNA13), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 13/IFNA13 Protein, Mouse (HEK293, His) contains 189 a.a. (M1-E189), produced in HEK293 cells with a C-terminal His-tag.

Background

IFN-alpha 13 (IFNA13; IFN-α13) is produced by the macrophages, belongs to the alpha/beta interferon (IFN) family, a family of cytokines induced by viral infection and are primarily involved in antiviral defense of the cells[1]. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively[2].
Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Interferon alpha (IFNa) shows significant biological activity in various cancers, paticularly haematological malignancies such as hairy cell leukaemia and chronic myelogenous leukaemia[3].
IFN-alpha13 exhibits acid-stable antiviral activity against Theiler's virus, Mengo virus, and vesicular stomatitis virus. Firstly, it is transcribed constitutively, independent of viral infection and of interferon regulatory factor-7 induction. Secondly, it contains two N-glycosylation sites, in contrast to other murine IFN-alpha subtypes that contain either one or no N-glycosylation site[4]. As for a wildly use of IFN in animal model, the sequence of amino acids in IFNA13 protein of human is very different from mouse (64.55%)

Biological Activity

Immobilized IFN-alpha 13 at 5 μg/mL (100 μL/well) can bind IFN Alpha Monoclonal antibody, The ED50 for this effect is 3.644 ng/mL.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q80SU4 (C24-E189)

Gene ID

230396  [NCBI]

Molecular Construction
N-term
IFNA13 (C24-E189)
Accession # Q80SU4
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interferon alpha-13; IFN-alpha-13; LeIF D; IFNA13
AA Sequence

CDLPQTHNLRNKRALTLLEQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPFVHELTQQILTLFTSNDSSAAWNATLLDSFCNDLHQQLNDLKACLMQQVGVQEFPLTQEDSLLAVRKYFHSITVYLREKKHSPCAWEVVRAEVQRTLSSSANLLARLSKEE

Molecular Weight

Approximately 20-30 kDa due to the glycosylation

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IFN-alpha 13/IFNA13 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-alpha 13/IFNA13 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P73125
Quantity:
MCE Japan Authorized Agent: