1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. IdeS Protein, Streptococcus pyogenes (N-His)

IdeS Protein is a highly specific IgG endopeptidase evolved from Streptococcus pyogenes, which can degrade IgG and participate in the immune response. IdeS Protein inhibits the function of certain neutrophil effectors, namely the production of reactive oxygen species (ROS), independently of IgG endopeptidase activity. IdeS Protein, Streptococcus pyogenes (N-His) is the recombinant IdeS protein, expressed by E. coli , with N-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IdeS Protein is a highly specific IgG endopeptidase evolved from Streptococcus pyogenes, which can degrade IgG and participate in the immune response. IdeS Protein inhibits the function of certain neutrophil effectors, namely the production of reactive oxygen species (ROS), independently of IgG endopeptidase activity. IdeS Protein, Streptococcus pyogenes (N-His) is the recombinant IdeS protein, expressed by E. coli , with N-10*His labeled tag.

Background

IdeS is a highly specific IgG endopeptidase evolved from Streptococcus pyogenes, which can not only degrade IgG but also directly or indirectly inhibit the innate immune response, thus promoting the survival of streptococcus in the inflammatory environment. IdeS was found to be identical to Mac-1 in Streptococcus, a protein thought to inhibit phagocytosis by inhibiting the recognition of IgG and/or complement configurations by the Fc receptor (CD16). IdeS/Mac-1 can inhibit the function of certain neutrophil effectors, namely the production of reactive oxygen species (ROS), independently of IgG endopeptidase activity[1][2].

Biological Activity

Measured by its ability to cleave human IgG. The DC50 is 49.93 ng, as measured under the described conditions.
The DC50 is defined as the amount of enzyme required to cleave 50% of 1 μg human IgG in 30 minutes at 37 °C. Use of Recombinant S.pyogenes IdeS in the cleavage of other IgGs may require alternative conditions for optimal performance.

Species

Others

Source

E. coli

Tag

N-10*His

Accession

F8V4V0 (D30-N341)

Gene ID

/

Molecular Construction
N-term
10*His
IdeS (D30-N341)
Accession # F8V4V0
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Immunoglubulin-degrading enzyme; ideS
AA Sequence

DSFSANQEIRYSEVTPYHVTSVWTKGVTPPAKFTQGEDVFHAPYVANQGWYDITKTFNGKDDLLCGAATAGNMLHWWFDQNKEKIEAYLKKHPDKQKIMFGDQELLDVRKVINTKGDQTNSELFNYFRDKAFPGLSARRIGVMPDLVLDMFINGYYLNVYKTQTTDVNRTYQEKDRRGGIFDAVFTRGDQSKLLTSRHDFKEKNLKEISDLIKKELTEGKALGLSHTYANVRINHVINLWGADFDSNGNLKAIYVTDSDSNASIGMKKYFVGVNSAGKVAISAKEIKEDNIGAQVLGLFTLSTGQDSWNQTN

Molecular Weight

Approximately 34 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IdeS Protein, Streptococcus pyogenes (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IdeS Protein, Streptococcus pyogenes (N-His)
Cat. No.:
HY-P74867A
Quantity:
MCE Japan Authorized Agent: