1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Stimulatory Immune Checkpoint Molecules T Cell CD Proteins
  4. ICOS/CD278 ICOS/CD278
  5. ICOS Protein, Rhesus macaque (HEK293,Fc)

ICOS proteins play a critical role in enhancing all basic T cell responses to foreign antigens. It promotes cell proliferation, lymphokine secretion and upregulation of intercellular interaction molecules, and promotes effective B cell antibody secretion. ICOS Protein, Rhesus macaque (HEK293,Fc) is the recombinant Rhesus Macaque-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ICOS proteins play a critical role in enhancing all basic T cell responses to foreign antigens. It promotes cell proliferation, lymphokine secretion and upregulation of intercellular interaction molecules, and promotes effective B cell antibody secretion. ICOS Protein, Rhesus macaque (HEK293,Fc) is the recombinant Rhesus Macaque-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The ICOS protein plays a crucial role in enhancing all fundamental T-cell responses to foreign antigens, including promoting cell proliferation, secretion of lymphokines, up-regulation of molecules involved in cell-cell interaction, and facilitating effective help for antibody secretion by B-cells. It is indispensable for facilitating efficient communication between T and B-cells, as well as for normal antibody responses to T-cell dependent antigens. Although it does not increase the production of interleukin-2, it has the ability to superinduce the synthesis of interleukin-10. Additionally, ICOS prevents the apoptosis of pre-activated T-cells and plays a critical role in CD40-mediated class switching of immunoglobulin isotypes. It exists as a homodimer connected by disulfide bonds.

Species

Rhesus Macaque

Source

HEK293

Tag

C-hFc

Accession

H9Z062 (G20-K140)

Gene ID
Molecular Construction
N-term
ICOS (G20-K140)
Accession # H9Z062
hFc
C-term
Protein Length

Partial

Synonyms
rRhInducible T-cell costimulator/ICOS, Fc ; Inducible T-cell costimulator; activation-inducible lymphocyte immunomediatory molecule; CD278; AILIM; CVID1; ICOS
AA Sequence

GEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDRSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK

Molecular Weight

50-60 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ICOS Protein, Rhesus macaque (HEK293,Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ICOS Protein, Rhesus macaque (HEK293,Fc)
Cat. No.:
HY-P70187
Quantity:
MCE Japan Authorized Agent: