1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Stimulatory Immune Checkpoint Molecules T Cell CD Proteins
  4. ICOS/CD278 ICOS/CD278
  5. ICOS Protein, Rat (HEK293, Fc)

ICOS is a key protein for T cell function and can significantly enhance various T cell responses to foreign antigens. It plays a crucial role in promoting T cell proliferation, lymphokine secretion and upregulation of intercellular interaction molecules, and promoting efficient secretion of B cell antibodies. ICOS Protein, Rat (HEK293, Fc) is the recombinant rat-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ICOS is a key protein for T cell function and can significantly enhance various T cell responses to foreign antigens. It plays a crucial role in promoting T cell proliferation, lymphokine secretion and upregulation of intercellular interaction molecules, and promoting efficient secretion of B cell antibodies. ICOS Protein, Rat (HEK293, Fc) is the recombinant rat-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag.

Background

ICOS, an essential protein in T-cell function, significantly enhances various T-cell responses to foreign antigens. It plays a pivotal role in promoting T-cell proliferation, secretion of lymphokines, up-regulation of cell-cell interaction molecules, and efficient assistance for B-cell antibody secretion. Notably, ICOS is indispensable for the normal antibody responses to T-cell dependent antigens, fostering the interaction between T and B-cells. Interestingly, ICOS does not elevate interleukin-2 production but superinduces the synthesis of interleukin-10. Additionally, it serves a crucial function in preventing the apoptosis of pre-activated T-cells and plays a significant role in CD40-mediated class switching of immunoglobulin isotypes. The protein forms homodimers through disulfide linkages, contributing to its multifaceted role in modulating immune responses.

Biological Activity

Measured by its ability to inhibit Jurkat proliferation induced by B7-H2 in the presence of anti-CD3. The ED50 for this effect is 3.252 µg/mL in the presence of 3 µg/mL Human B7‑H2 and 20 ng/mL of anti-CD3, corresponding to a specific activity is 307.503 units/mg.

  • Measured by its ability to inhibit Jurkat proliferation induced by B7-H2 in the presence of anti-CD3. The ED50 for this effect is 3.252 µg/mL in the presence of 3 µg/mL Human B7-H2 and 20 ng/mL of anti-CD3, corresponding to a specific activity is 307.503 units/mg.
Species

Rat

Source

HEK293

Tag

C-hFc

Accession

Q9R1T7-1 (E21-L142)

Gene ID
Molecular Construction
N-term
ICOS (E21-L142)
Accession # Q9R1T7-1
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Inducible T-cell costimulator; CD278; AILIM; CVID1; ICOS
AA Sequence

ELNDLANHRMFSFHDGGVQISCNYPETVQQLKMQLFKDREVLCDLTKTKGSGNTVSIKNPMSCPYQLSNNSVSFFLDNADSSQGSYFLCSLSIFDPPPFQEKNLSGGYLLIYESQLCCQLKL

Molecular Weight

Approximately 43-50 kDa due to the glycosylation

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ICOS Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ICOS Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P74868
Quantity:
MCE Japan Authorized Agent: