1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Stimulatory Immune Checkpoint Molecules T Cell CD Proteins
  4. ICOS/CD278 ICOS/CD278
  5. ICOS Protein, Mouse (C137S, C138S, HEK293, Fc)

ICOS proteins optimize T cell responses to foreign antigens, promoting proliferation, lymphokine secretion, upregulation of cell-cell interaction molecules, and efficient B cell antibody secretion. ICOS is essential for efficient communication of T cells and B cells and for normal antibody responses to T cell-dependent antigens. ICOS Protein, Mouse (C137S, C138S, HEK293, Fc) is the recombinant mouse-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag and C137S, C138S mutation.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ICOS proteins optimize T cell responses to foreign antigens, promoting proliferation, lymphokine secretion, upregulation of cell-cell interaction molecules, and efficient B cell antibody secretion. ICOS is essential for efficient communication of T cells and B cells and for normal antibody responses to T cell-dependent antigens. ICOS Protein, Mouse (C137S, C138S, HEK293, Fc) is the recombinant mouse-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag and C137S, C138S mutation.

Background

The ICOS protein enhances all fundamental T-cell responses to foreign antigens, including proliferation, secretion of lymphokines, up-regulation of cell-cell interaction molecules, and providing effective help for antibody secretion by B-cells. It is essential for facilitating efficient communication between T and B-cells and for normal antibody responses to T-cell dependent antigens. Although it does not increase the production of interleukin-2, it superinduces the synthesis of interleukin-10. Additionally, it prevents apoptosis of pre-activated T-cells and plays a critical role in CD40-mediated class switching of immunoglobulin isotypes. ICOS exists as a homodimer, connected by disulfide bonds.

Biological Activity

1. Immobilized Human B7-H2 His at 1 μg/mL (100 μL/well) can bind Mouse ICOS (C137S C138S, Fc) with a linear range of 0.3-10 ng/mL.
2. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse ICOS at 1 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human rhB7-H2. The ED50 for this effect is 37.18 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse ICOS at 1 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human rhB7-H2 .The ED50 for this effect is 37.18 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q9WVS0 (E21-L144, C137S, C138S)

Gene ID
Molecular Construction
N-term
ICOS (E21-L144, C137S, C138S)
Accession # Q9WVS
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
ICOS; CD278; AILIM; Inducible T-cell costimulator
AA Sequence

EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLSSQLKLWL

Molecular Weight

40-52 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of Tris with Glycine, Arginine and NaCl, pH 7.5. Normally trehalose is added as protectant before lyophilization. or 20 mM PB, 150 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ICOS Protein, Mouse (C137S, C138S, HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ICOS Protein, Mouse (C137S, C138S, HEK293, Fc)
Cat. No.:
HY-P78673
Quantity:
MCE Japan Authorized Agent: