1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Stimulatory Immune Checkpoint Molecules T Cell CD Proteins
  4. ICOS/CD278 ICOS/CD278
  5. ICOS Protein, Human (HEK293, Fc)

ICOS proteins enhance T cell responses to foreign antigens, promote proliferation, lymphokine secretion, upregulation of cell-cell interaction molecules, and help B cells secrete antibodies. ICOS Protein, Human (HEK293, Fc) is the recombinant human-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ICOS proteins enhance T cell responses to foreign antigens, promote proliferation, lymphokine secretion, upregulation of cell-cell interaction molecules, and help B cells secrete antibodies. ICOS Protein, Human (HEK293, Fc) is the recombinant human-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag.

Background

ICOS protein significantly enhances fundamental T-cell responses to foreign antigens, encompassing key activities such as cellular proliferation, lymphokine secretion, up-regulation of cell-cell interaction molecules, and effective facilitation of antibody secretion by B-cells. It proves essential for the efficient interplay between T and B-cells, crucial for normal antibody responses to T-cell-dependent antigens. Despite not influencing the production of interleukin-2, ICOS protein superinduces the synthesis of interleukin-10 and prevents the apoptosis of pre-activated T-cells. Moreover, ICOS plays a critical role in CD40-mediated class switching of immunoglobulin isotypes, demonstrating its multifaceted role in orchestrating immune responses. The protein forms homodimers linked by disulfide bonds, further contributing to its functional characteristics.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q9Y6W8-1 (E21-F141)

Gene ID
Protein Length

Partial

Synonyms
Inducible T-cell costimulator; CD278; AILIM; CVID1; ICOS
AA Sequence

EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKF

Molecular Weight

Approximately 47 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 .

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ICOS Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ICOS Protein, Human (HEK293, Fc)
Cat. No.:
HY-P72618
Quantity:
MCE Japan Authorized Agent: