1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. NK Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Platelet CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. ICAM-1/CD54 Immunoglobulin-like Cell Adhesion Molecules
  5. ICAM-1/CD54
  6. ICAM-1/CD54 Protein, Human (HEK293, Fc)

The ICAM-1/CD54 protein plays a crucial role in cell interactions, acting as a ligand for the leukocyte adhesion protein LFA-1. It promotes leukocyte transendothelial migration by promoting the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation. ICAM-1/CD54 Protein, Human (HEK293, Fc) is the recombinant human-derived ICAM-1/CD54 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ICAM-1/CD54 protein plays a crucial role in cell interactions, acting as a ligand for the leukocyte adhesion protein LFA-1. It promotes leukocyte transendothelial migration by promoting the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation. ICAM-1/CD54 Protein, Human (HEK293, Fc) is the recombinant human-derived ICAM-1/CD54 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

ICAM-1/CD54 protein emerges as a crucial player in cellular interactions, functioning as a ligand for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). Particularly notable is its role during leukocyte trans-endothelial migration, where engagement with ICAM-1 promotes the assembly of endothelial apical cups through the activation of ARHGEF26/SGEF and RHOG. In the context of microbial infection, ICAM-1 also acts as a receptor for major receptor group rhinovirus A-B capsid proteins, highlighting its versatile involvement in both immune responses and pathogen recognition. This dual functionality underscores the significance of ICAM-1 in mediating diverse cellular processes critical for immune regulation and host defense.

Biological Activity

Measured by its ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. When 5×104 cells/well are added to ICAM-1 coated plates (12.5 μg/mL,100 μL/well) in the presence of 20 ng/mL PMA, approximately 79.7% will adhere after 1 hour at 37°C.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

P05362/NP_000192.2 (Q28-E480)

Gene ID
Molecular Construction
N-term
ICAM-1 (Q28-E480)
Accession # P05362/NP_000192.2
hFc
C-term
Synonyms
Intercellular Adhesion Molecule 1; ICAM-1; CD54
AA Sequence

QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE

Molecular Weight

Approximately 95-135 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ICAM-1/CD54 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ICAM-1/CD54 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P73910
Quantity:
MCE Japan Authorized Agent: