1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. HSD11B1 Protein, Human (His-SUMO)

The proteins encoded by ED genes are involved in a variety of physiological processes. HSD11B1 Protein, Human (His-SUMO) is the recombinant human-derived HSD11B1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The proteins encoded by ED genes are involved in a variety of physiological processes. HSD11B1 Protein, Human (His-SUMO) is the recombinant human-derived HSD11B1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

HSD11B1 protein governs the reversible conversion of biologically active glucocorticoids, such as cortisone to cortisol, and 11-dehydrocorticosterone to corticosterone, in the presence of NADP(H). This enzymatic activity is crucial for the corticosteroid receptor-mediated anti-inflammatory response, as well as metabolic and homeostatic processes. Additionally, HSD11B1 plays a role in the secretion of aqueous humor in the eye, contributing to the maintenance of a normotensive, intraocular environment. While displaying bidirectional capabilities in vitro, it predominantly functions as a reductase in vivo, thereby increasing the concentration of active glucocorticoids. The enzyme exhibits broad substrate specificity, accepting various steroid and sterol substrates. Notably, it interconverts 7-oxo- and 7-hydroxy-neurosteroids, such as 7-oxopregnenolone and 7beta-hydroxypregnenolone, 7-oxodehydroepiandrosterone and 7beta-hydroxydehydroepiandrosterone, among others. Furthermore, HSD11B1 catalyzes the stereo-specific conversion of the major dietary oxysterol, 7-ketocholesterol, into the more polar 7-beta-hydroxycholesterol metabolite, a process with implications in apoptosis, atherosclerotic lesions, lipid peroxidation, and foam cell formation. Moreover, it mediates the 7-oxo reduction of 7-oxolithocholate, providing a link between glucocorticoid activation and bile acid metabolism, ultimately influencing immune cell migration through the synthesis of 7-beta-25-dihydroxycholesterol, a ligand for the G-protein-coupled receptor Epstein-Barr virus-induced gene 2 (EBI2).

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

P28845 (E25-K292)

Gene ID
Molecular Construction
N-term
6*His-SUMO
HSD11B1 (E25-K292)
Accession # P28845
C-term
Synonyms
11 beta HSD 1; 11 beta HSD1 ; 11 beta hydroxysteroid dehydrogenase 1; 11 DH ; 11-beta hydroxysteroid dehydrogenase; type 1; 11-beta-HSD1; 11-DH; 11DH ; Corticosteroid 11 beta dehydrogenase isozyme 1; Corticosteroid 11-beta-dehydrogenase isozyme 1; CORTRD2; DHI1_HUMAN; HDL; HSD 11; HSD11; HSD11B; HSD11B1; HSD11L; member 1
AA Sequence

EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK

Molecular Weight

Approximately 45.5 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

HSD11B1 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HSD11B1 Protein, Human (His-SUMO)
Cat. No.:
HY-P72237
Quantity:
MCE Japan Authorized Agent: