1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. HO-1 Protein, Human

HO-1 Protein, an enzyme, plays a critical role in cellular defense against oxidative stress and inflammation. Dysregulation of HO-1 Protein has been implicated in several diseases, including cardiovascular disorders and neuroinflammatory conditions. Targeting HO-1 Protein may offer potential therapeutic interventions by enhancing antioxidant defenses, reducing inflammation, and potentially treating these diseases. HO-1 Protein, Human is the recombinant human-derived HO-1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg Get quote
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE HO-1 Protein, Human

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HO-1 Protein, an enzyme, plays a critical role in cellular defense against oxidative stress and inflammation. Dysregulation of HO-1 Protein has been implicated in several diseases, including cardiovascular disorders and neuroinflammatory conditions. Targeting HO-1 Protein may offer potential therapeutic interventions by enhancing antioxidant defenses, reducing inflammation, and potentially treating these diseases. HO-1 Protein, Human is the recombinant human-derived HO-1 protein, expressed by E. coli , with tag free.

Background

The HO-1 protein serves as a catalyst for the oxidative cleavage of heme at the alpha-methene bridge carbon, resulting in the release of carbon monoxide (CO) and the generation of biliverdin IXalpha, while concurrently releasing the central heme iron chelate as ferrous iron. This process has been extensively documented in various publications. Moreover, HO-1 protein plays a crucial role in safeguarding against programmed cell death by catabolizing free heme, thereby preventing its ability to sensitize cells and induce apoptosis. Numerous studies have affirmed the cytoprotective effect of HO-1 protein. Additionally, in the context of microbial infection, it has been observed that during SARS-CoV-2 infection, HO-1 protein promotes SARS-CoV-2 ORF3A-mediated autophagy, although it is not deemed necessary for the induction of reticulophagy by ORF3A.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P09601 (M1-T261)

Gene ID
Molecular Construction
N-term
HO-1 (M1-T261)
Accession # P09601
C-term
Protein Length

Cytoplasmic Domain

Synonyms
rHuHeme oxygenase 1/HO-1; Heme Oxygenase 1; HO-1; HMOX1; HO; HO1
AA Sequence

MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNT

Predicted Molecular Mass
29.8 kDa
Molecular Weight

Approximately 30.8 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE..
Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 1 mM EDTA, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

HO-1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HO-1 Protein, Human
Cat. No.:
HY-P70276
Quantity:
MCE Japan Authorized Agent: