1. Recombinant Proteins
  2. Others
  3. HNRNPA2B1 Protein, Mouse (His-SUMO, Myc)

The HNRNPA2B1 protein is an important heterogeneous nuclear ribonucleoprotein (hnRNP) that plays a key role in RNA processing and transport. It forms hnRNP particles that compact and stabilize transcripts to influence various cellular functions, including transcription, mRNA processing, nuclear export, localization, translation, and mRNA stability. HNRNPA2B1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived HNRNPA2B1 protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The HNRNPA2B1 protein is an important heterogeneous nuclear ribonucleoprotein (hnRNP) that plays a key role in RNA processing and transport. It forms hnRNP particles that compact and stabilize transcripts to influence various cellular functions, including transcription, mRNA processing, nuclear export, localization, translation, and mRNA stability. HNRNPA2B1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived HNRNPA2B1 protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.

Background

HNRNPA2B1 Protein, a heterogeneous nuclear ribonucleoprotein (hnRNP), plays a pivotal role in RNA processing and transport. It associates with nascent pre-mRNAs, participating in the formation of hnRNP particles that condense and stabilize transcripts, minimizing tangling and knotting. This packaging process influences various cellular functions, including transcription, pre-mRNA processing, RNA nuclear export, subcellular localization, mRNA translation, and the stability of mature mRNAs. HNRNPA2B1 forms hnRNP particles with multiple hnRNPs and heterogeneous nuclear RNAs in the nucleus. Notably, in oligodendrocytes and neurons, it facilitates the transport of specific mRNAs to the cytoplasm by recognizing and binding A2RE or A2RE11 sequence motifs on select mRNAs. Beyond mRNA transport, HNRNPA2B1 also binds telomeric DNA sequences, protecting them from endonuclease digestion, and acts as a 'reader' of the N6-methyladenosine (m6A) mark on pri-miRNAs, promoting pri-miRNA processing and miRNA sorting into exosomes. Additionally, it serves as a regulator of mRNA splicing, impacting the splicing of genes like pyruvate kinase PKM. Furthermore, HNRNPA2B1 is implicated in the activation of the innate immune response, sensing viral DNA, and translocating to the cytoplasm to activate the TBK1-IRF3 pathway. These diverse functions highlight the versatility of HNRNPA2B1 in cellular processes.

Species

Mouse

Source

E. coli

Tag

N-10*His;N-SUMO;C-Myc

Accession

O88569 (M1-Y353)

Gene ID
Molecular Construction
N-term
10*His-SUMO
HNRNPA2B1 (M1-Y353)
Accession # O88569
Myc
C-term
Protein Length

Full Length

Synonyms
Hnrnpa2b1; Hnrpa2b1; Heterogeneous nuclear ribonucleoproteins A2/B1; hnRNP A2/B1
AA Sequence

MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGSYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY

Molecular Weight

Approximately 57.4 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered PBS,6% Trehalose, pH 7.4

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

HNRNPA2B1 Protein, Mouse (His-SUMO, Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HNRNPA2B1 Protein, Mouse (His-SUMO, Myc)
Cat. No.:
HY-P72232
Quantity:
MCE Japan Authorized Agent: