1. Recombinant Proteins
  2. Others
  3. HN1 Protein, Mouse (His)

HN1 protein negatively regulates AKT-mediated GSK3B signaling and induces the phosphorylation and degradation of CTNNB1 at “Ser-33”. This effect inhibits the “Ser-9” phosphorylation of GSK3B, inhibits the activity of APC:CTNNB1:GSK3B complex and blocks its interaction with CDH1. HN1 Protein, Mouse (His) is the recombinant mouse-derived HN1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HN1 protein negatively regulates AKT-mediated GSK3B signaling and induces the phosphorylation and degradation of CTNNB1 at “Ser-33”. This effect inhibits the “Ser-9” phosphorylation of GSK3B, inhibits the activity of APC:CTNNB1:GSK3B complex and blocks its interaction with CDH1. HN1 Protein, Mouse (His) is the recombinant mouse-derived HN1 protein, expressed by E. coli , with N-His labeled tag.

Background

HN1 protein emerges as a key regulator in cellular processes, exerting a negative modulatory effect on AKT-mediated GSK3B signaling. It functions by inducing the phosphorylation and subsequent degradation of CTNNB1 at 'Ser-33.' This action is achieved through the suppression of the inhibitory 'Ser-9' phosphorylation of GSK3B, thereby dampening the activity of the APC:CTNNB1:GSK3B complex and impeding its interaction with CDH1/E-cadherin in adherent junctions. Beyond its role in cell adhesion, HN1 participates in the regulation of cell cycle dynamics, as evidenced by its impact on these fundamental cellular processes. Moreover, HN1 exhibits an inhibitory role in the AR-signaling pathway, contributing to the proteasomal degradation of the receptor. Notably, HN1 engages in interactions with the APC:CTNNB1:GSK3B complex, specifically with the inactive form of GSK3B phosphorylated at 'Ser-9,' highlighting its involvement in intricate cellular signaling networks.

Species

Mouse

Source

E. coli

Tag

N-His

Accession

P97825 (M1-G154)

Gene ID
Molecular Construction
N-term
His
HN1 (M1-G154)
Accession # P97825
C-term
Protein Length

Full Length

Synonyms
Jupiter microtubule associated homolog 1; Jpt1; Hn1
AA Sequence

MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPAEQPVRKNKMASNIFGTPEENPPSWAKSAGSKSSGGREDSESPGTQRSNSSEASSGDFLDLKGEGDMHENVDTDFQANLAQMEEKPVPAAPVPSPVAPAPVPSRRNPPGGKSSLVLG

Molecular Weight

Approximately 24 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HN1 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HN1 Protein, Mouse (His)
Cat. No.:
HY-P74880
Quantity:
MCE Japan Authorized Agent: