1. Recombinant Proteins
  2. Others
  3. HMGN3 Protein, Human (His)

HMGN3 binds to nucleosomes, regulates chromatin structure, and affects chromatin-dependent processes such as transcription and DNA repair. It affects insulin and glucagon levels and regulates pancreatic gene expression related to insulin secretion. HMGN3 Protein, Human (His) is the recombinant human-derived HMGN3 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HMGN3 binds to nucleosomes, regulates chromatin structure, and affects chromatin-dependent processes such as transcription and DNA repair. It affects insulin and glucagon levels and regulates pancreatic gene expression related to insulin secretion. HMGN3 Protein, Human (His) is the recombinant human-derived HMGN3 protein, expressed by E. coli , with N-His labeled tag.

Background

HMGN3, a protein with the capability to bind to nucleosomes, exerts regulatory control over chromatin structure, thereby influencing various chromatin-dependent processes, including transcription, DNA replication, and DNA repair. It plays a role in the modulation of insulin and glucagon levels and participates in the regulation of pancreatic genes involved in insulin secretion. HMGN3 specifically binds to the promoter region of the glucose transporter SLC2A2, recruiting transcription factors such as PDX1, thereby impacting glucose homeostasis. Additionally, it regulates the expression of SLC6A9, a glycine transporter crucial for maintaining glycine concentration in synaptic junctions within the central nervous system. Beyond its metabolic functions, HMGN3 may also contribute to ocular development and astrocyte function. Furthermore, HMGN3 engages in interactions with the ligand binding domain of the thyroid receptor, requiring the presence of thyroid hormone for its activity, and interacts with the transcriptional regulator SEHBP, highlighting its multifaceted roles in cellular and physiological processes.

Species

Human

Source

E. coli

Tag

N-10*His

Accession

Q15651-2 (M1-N77)

Gene ID
Molecular Construction
N-term
His
HMGN3 (M1-N77)
Accession # Q15651-2
C-term
Protein Length

Full Length of Isoform-2

Synonyms
High mobility group nucleosome-binding domain-containing protein 3; TRIP-7; HMGN3
AA Sequence

MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTEN

Molecular Weight

Approximately 17 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HMGN3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HMGN3 Protein, Human (His)
Cat. No.:
HY-P75810
Quantity:
MCE Japan Authorized Agent: