1. Recombinant Proteins
  2. Others
  3. HLP2/HPCAL1 Protein, Human (His)

The HLP2/HPCAL1 protein emerged as a potential regulator of calcium-dependent rhodopsin phosphorylation, suggesting a role in regulating this critical process of visual signal transduction. Its complex interactions with calcium-mediated pathways suggest its importance in the precise control of rhodopsin function, influencing visual signaling. HLP2/HPCAL1 Protein, Human (His) is the recombinant human-derived HLP2/HPCAL1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The HLP2/HPCAL1 protein emerged as a potential regulator of calcium-dependent rhodopsin phosphorylation, suggesting a role in regulating this critical process of visual signal transduction. Its complex interactions with calcium-mediated pathways suggest its importance in the precise control of rhodopsin function, influencing visual signaling. HLP2/HPCAL1 Protein, Human (His) is the recombinant human-derived HLP2/HPCAL1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

HLP2/HPCAL1 Protein emerges as a potential player in the finely tuned calcium-dependent regulation of rhodopsin phosphorylation. Its involvement suggests a role in modulating the phosphorylation dynamics of rhodopsin, a crucial process in the regulation of visual signal transduction. The intricate interplay between HLP2/HPCAL1 and calcium-mediated pathways hints at its potential significance in the precise control of rhodopsin function and, consequently, visual signaling. Unraveling the specific mechanisms through which HLP2/HPCAL1 contributes to rhodopsin phosphorylation may offer valuable insights into the molecular intricacies of visual signal processing and the broader regulatory mechanisms in sensory perception. Exploring the functional significance of HLP2/HPCAL1 in the context of calcium-dependent rhodopsin regulation could deepen our understanding of its role in maintaining visual sensitivity and adaptation.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P37235 (M1-F193)

Gene ID
Molecular Construction
N-term
6*His
HPCAL1 (M1-F193)
Accession # P37235
C-term
Protein Length

Full Length

Synonyms
rHuHippocalcin-like protein 1/HPCAL1, His; Hippocalcin-Like Protein 1; Calcium-Binding Protein BDR-1; HLP2; Visinin-Like Protein 3; VILIP-3; HPCAL1; BDR1
AA Sequence

MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF

Predicted Molecular Mass
24.5 kDa
Molecular Weight

Approximately 21 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

HLP2/HPCAL1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HLP2/HPCAL1 Protein, Human (His)
Cat. No.:
HY-P70346
Quantity:
MCE Japan Authorized Agent: