1. Recombinant Proteins
  2. Others
  3. HLA-DRB1 Protein, Human (Myc, His-SUMO)

HLA-DRB1 protein, as the beta chain of MHCII, guides T cell recognition, orchestrates immune responses against pathogens and tumors, and adapts its antigen presentation in the tumor microenvironment, ensuring a diverse role in immune responses and tolerance mechanisms, notably influenced by specific alleles like DRB1*01:01. HLA-DRB1 Protein, Human (Myc, His-SUMO) is the recombinant human-derived HLA-DRB1 protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HLA-DRB1 protein, as the beta chain of MHCII, guides T cell recognition, orchestrates immune responses against pathogens and tumors, and adapts its antigen presentation in the tumor microenvironment, ensuring a diverse role in immune responses and tolerance mechanisms, notably influenced by specific alleles like DRB1*01:01. HLA-DRB1 Protein, Human (Myc, His-SUMO) is the recombinant human-derived HLA-DRB1 protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

Background

The HLA-DRB1 protein serves as the beta chain of the antigen-presenting major histocompatibility complex class II (MHCII) molecule, forming a complex with the alpha chain HLA-DRA. This complex plays a pivotal role in presenting antigenic peptides on professional antigen-presenting cells (APCs), guiding alpha-beta T cell receptor (TCR) recognition by HLA-DRB1-restricted CD4-positive T cells. The process facilitates antigen-specific T-helper effector functions, including both antibody-mediated immune responses and macrophage activation, leading to the elimination of infectious agents and transformed cells. The protein typically presents extracellular peptide antigens of 10 to 30 amino acids, originating from the proteolysis of endocytosed antigens in lysosomes. In the tumor microenvironment, HLA-DRB1 presents antigenic peptides primarily generated in tumor-resident APCs, potentially via phagocytosis of apoptotic tumor cells or macropinocytosis of secreted tumor proteins. Additionally, it presents peptides derived from intracellular proteins trapped in autolysosomes after macroautophagy, a mechanism relevant for T cell selection in the thymus and central immune tolerance. The selection of immunodominant epitopes follows distinct processing modes for pathogen-derived antigenic peptides and autoantigens/self-peptides. The anchor residue at position 1 of the peptide N-terminus, typically a large hydrophobic residue, is crucial for a high-affinity interaction with MHCII molecules. Specific alleles, such as DRB1*01:01, display immunodominant epitopes derived from various pathogens, illustrating the protein's diverse role in immune responses and tolerance mechanisms.

Species

Human

Source

E. coli

Tag

N-His;C-Myc;N-SUMO

Accession

P01911 (G30-K227)

Gene ID
Molecular Construction
N-term
10*His-SUMO
HLA-DRB1 (G30-K227)
Accession # P01911
Myc
C-term
Protein Length

Extracellular Domain

Synonyms
HLA class II histocompatibility antigen, DRB1 beta chain; Human leukocyte antigen DRB1
AA Sequence

GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSK

Molecular Weight

Approximately 44 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HLA-DRB1 Protein, Human (Myc, His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HLA-DRB1 Protein, Human (Myc, His-SUMO)
Cat. No.:
HY-P71505
Quantity:
MCE Japan Authorized Agent: