1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. Histo-blood group ABO/ABO Protein, Human (HEK293, Fc)

Histo-blood group ABO/ABO Protein, Human (HEK293, Fc)

Cat. No.: HY-P73926
Handling Instructions Technical Support

The Histo-blood group ABO/ABO Protein is an enzyme encoded by the human ABO gene with glycosyltransferase activity. ABO Protein is associated with a variety of infectious and non-communicable diseases. ABO blood group can be used as a tumor marker. Histo-blood group ABO/ABO Protein, Human (HEK293, Fc) is the recombinant human-derived Histo-blood group ABO/ABO protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg Get quote
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Histo-blood group ABO/ABO Protein is an enzyme encoded by the human ABO gene with glycosyltransferase activity. ABO Protein is associated with a variety of infectious and non-communicable diseases. ABO blood group can be used as a tumor marker. Histo-blood group ABO/ABO Protein, Human (HEK293, Fc) is the recombinant human-derived Histo-blood group ABO/ABO protein, expressed by HEK293 , with N-hFc labeled tag.

Background

Tissue blood group ABO system transferase is an enzyme encoded by human ABO gene with glycosyltransferase activity. It is commonly expressed in many tissues and cell types. ABO determines an individual's ABO blood type by modifying oligosaccharides on cell surface glycoproteins. Differences in protein sequences between individuals determine the type of modification and blood type. The ABO gene also contains one of 27 SNPs associated with an increased risk of coronary artery disease. Genetically determined ABO blood groups in humans are associated with an increased risk of various infectious and non-communicable diseases. ABO blood group can be used as tumor marker[1][2][3].

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

ADX99264 (R63-P354)

Gene ID

28  [NCBI]

Molecular Construction
N-term
hFc
ABO (R63-P354)
Accession # ADX99264
C-term
Synonyms
Histo-blood group ABO system transferase; ABO; NAGAT
AA Sequence

RVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP

Molecular Weight

Approximately 62-68 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Histo-blood group ABO/ABO Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Histo-blood group ABO/ABO Protein, Human (HEK293, Fc)
Cat. No.:
HY-P73926
Quantity:
MCE Japan Authorized Agent: