1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Hirudin Protein, Poecilobdella viridis (P. pastoris)

Hirudin Protein, Poecilobdella viridis (P. pastoris)

Cat. No.: HY-P72799
Handling Instructions Technical Support

Hirudin Protein, a powerful thrombin-specific protease inhibitor, forms a stable non-covalent complex with alpha-thrombin, effectively preventing fibrinogen cleavage. This interaction underscores hirudin's critical role in regulating key coagulation cascade steps. Its specific thrombin inhibition emphasizes hirudin's significance as a therapeutic agent, particularly for precise blood clotting regulation. Hirudin Protein, Poecilobdella viridis (P. pastoris) is the recombinant Hirudin protein, expressed by P. pastoris , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Hirudin Protein, a powerful thrombin-specific protease inhibitor, forms a stable non-covalent complex with alpha-thrombin, effectively preventing fibrinogen cleavage. This interaction underscores hirudin's critical role in regulating key coagulation cascade steps. Its specific thrombin inhibition emphasizes hirudin's significance as a therapeutic agent, particularly for precise blood clotting regulation. Hirudin Protein, Poecilobdella viridis (P. pastoris) is the recombinant Hirudin protein, expressed by P. pastoris , with tag free.

Background

Hirudin Protein emerges as a potent thrombin-specific protease inhibitor, showcasing its ability to form a stable non-covalent complex with alpha-thrombin. This interaction results in the effective abolition of alpha-thrombin's capacity to cleave fibrinogen, underscoring the critical role of hirudin in modulating key steps in the coagulation cascade. The specific and targeted inhibition of thrombin by hirudin highlights its significance as a therapeutic agent, particularly in contexts where precise regulation of blood clotting is essential.

Biological Activity

The biological activity is determined by chromogenic assay, 1 unit is defined as the amount of Hirudin that neutralizes 1 unit of the WHO preparation 89/588 of thrombin. The specific activity is no less than 14,000 ATU/mg protein.

Species

Others

Source

P. pastoris

Tag

Tag Free

Accession

P84590 (V1-L63)

Gene ID

/

Molecular Construction
N-term
Hirudin (V1-L63)
Accession # P84590
C-term
Protein Length

Full Length

Synonyms
Hirudin
AA Sequence

VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPGPQSHNDGDFEEPEEYL

Molecular Weight

Approximately 6.7 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PBS, pH 7.0, containing 2 % mannitol.

Endotoxin Level

<1 EU/μg; determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Hirudin Protein, Poecilobdella viridis (P. pastoris) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Hirudin Protein, Poecilobdella viridis (P. pastoris)
Cat. No.:
HY-P72799
Quantity:
MCE Japan Authorized Agent: