1. Recombinant Proteins
  2. Others
  3. HGFA/HGF Activator Protein, Mouse (HEK293, His)

HGFA/HGF Activator Protein, Mouse (HEK293, His)

Cat. No.: HY-P77960
Handling Instructions Technical Support

HGFA/HGF activating proteins activate HGF by converting HGF into its heterodimeric form, which is critical for cell growth, development, and tissue repair. It induces cellular responses such as proliferation, migration, and differentiation. HGFA/HGF Activator Protein, Mouse (HEK293, His) is the recombinant mouse-derived HGFA/HGF Activator protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HGFA/HGF activating proteins activate HGF by converting HGF into its heterodimeric form, which is critical for cell growth, development, and tissue repair. It induces cellular responses such as proliferation, migration, and differentiation. HGFA/HGF Activator Protein, Mouse (HEK293, His) is the recombinant mouse-derived HGFA/HGF Activator protein, expressed by HEK293 , with C-6*His labeled tag.

Background

HGFA/HGF Activator Protein is responsible for activating hepatocyte growth factor (HGF) by converting it from a single chain to a heterodimeric form. This heterodimer consists of a short chain and a long chain that are linked together by a disulfide bond. HGFA/HGF Activator Protein plays a crucial role in various biological processes, including cell growth, development, and tissue repair. Its activation of HGF leads to the induction of cellular responses such as cell proliferation, migration, and differentiation. By modulating HGF activity, HGFA/HGF Activator Protein contributes to the regulation of cell-matrix adhesion, cell-cell adhesion, and cell morphology. It interacts with various proteins, including THSD1, PTK2/FAK1, TLN1, and VCL, and its association with CTNNA1 is essential for its localization to cell-cell junctions and the regulation of E-cadherin expression. Moreover, HGFA/HGF Activator Protein forms a complex with APBB1IP, NRAP, TLN1, CTNNB1, SYNM, SORBS1, and CTNNA1, and it triggers conformational changes when binding to ACTN4. Its multifaceted interactions and activities highlight its importance in cellular processes and underline its potential therapeutic applications.

Biological Activity

Measured in a cell proliferation assay using hepG2 human hepatocellular carcinoma cells. The ED50 for this effect is 0.951 μg/mL, corresponding to a specific activity is 5.126×103 U/mg.

  • Measured in a cell proliferation assay using hepG2 human hepatocellular carcinoma cells. The ED50 for this effect is 0.951 μg/mL, corresponding to a specific activity is 5.126×103 U/mg.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q9R098 (Q35-S653)

Gene ID
Molecular Construction
N-term
HGFA (Q35-S653)
Accession # Q9R098
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
HGF activator; HGFA; Hgfac; MGC138395; MGC138397
AA Sequence

QAGRNHTEPPGPNVTATPVTPTIPVISGNVSTSTESAPAAETEGPQSERYPPPSSSSPPGGQVLTESGQPCRFPFRYGGRMLHSCTSEGSAYRKWCATTHNYDRDRAWGYCAEVTLPVEGPAILDPCASGPCLNGGTCSSTHDHGSYHCSCPLAFTGKDCGTEKCFDETRYEYFEVGDHWARVSEGHVEQCGCMEGQARCEDTHHTACLSSPCLNGGTCHLIVGTGTSVCTCPLGYAGRFCNIVPTEHCFLGNGTEYRGVASTAASGLSCLAWNSDLLYQELHVDSVAAAVLLGLGPHAYCRNPDKDERPWCYVVKDNALSWEYCRLTACESLARVHSQTPEILAALPESAPAVRPTCGKRHKKRTFLRPRIIGGSSSLPGSHPWLAAIYIGNSFCAGSLVHTCWVVSAAHCFANSPPRDSITVVLGQHFFNRTTDVTQTFGIEKYVPYTLYSVFNPNNHDLVLIRLKKKGERCAVRSQFVQPICLPEAGSSFPTGHKCQIAGWGHMDENVSSYSNSLLEALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLVCEKNGVAYLYGIISWGDGCGRLNKPGVYTRVANYVDWINDRIRPPKRPVATS

Molecular Weight

approximately 107.5 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris,150 mM NaCl, 2 mM CaCl2, pH 8.0 or 20 mM PB, 150 mM NaCl, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HGFA/HGF Activator Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HGFA/HGF Activator Protein, Mouse (HEK293, His)
Cat. No.:
HY-P77960
Quantity:
MCE Japan Authorized Agent: