1. Recombinant Proteins
  2. Others
  3. Hemopexin Protein, Rat (His)

Hemopexin Protein, with its heme-binding ability, acts as a transporter, facilitating heme transport to the liver. In the liver, heme is broken down, and the recovered iron is utilized. The liberated hemopexin protein then returns to circulation, underscoring its vital role in efficiently managing heme and iron metabolism in the body. Hemopexin Protein, Rat (His) is the recombinant rat-derived Hemopexin protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Hemopexin Protein, with its heme-binding ability, acts as a transporter, facilitating heme transport to the liver. In the liver, heme is broken down, and the recovered iron is utilized. The liberated hemopexin protein then returns to circulation, underscoring its vital role in efficiently managing heme and iron metabolism in the body. Hemopexin Protein, Rat (His) is the recombinant rat-derived Hemopexin protein, expressed by E. coli , with N-6*His labeled tag.

Background

The Hemopexin protein exhibits the ability to bind to heme, serving as a transporter to facilitate its transportation to the liver. Once in the liver, heme is broken down, and the iron is recovered. Subsequently, the hemopexin protein, now free from heme, returns to circulation. This mechanism highlights the crucial role of hemopexin in the efficient management of heme and iron metabolism within the body.

Species

Rat

Source

E. coli

Tag

N-6*His

Accession

P20059 (N24-Q460)

Gene ID
Molecular Construction
N-term
6*His
Hemopexin (N24-Q460)
Accession # P20059
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Hpx; Hemopexin
AA Sequence

NPLPAAHETVAKGENGTKPDSDVIEHCSDAWSFDATTMDHNGTMLFFKGEFVWRGHSGIRELISERWKNPVTSVDAAFRGPDSVFLIKEDKVWVYPPEKKENGYPKLFQEEFPGIPYPPDAAVECHRGECQSEGVLFFQGNRKWFWDFATRTQKERSWPAVGNCTAALRWLERYYCFQGNKFLRFNPVTGEVPPRYPLDARDYFISCPGRGHGKLRNGTAHGNSTHPMHSRCNADPGLSALLSDHRGATYAFSGSHYWRLDSSRDGWHSWPIAHHWPQGPSAVDAAFSWDEKVYLIQGTQVYVFLTKGGNNLVSGYPKRLEKELGSPPGISLDTIDAAFSCPGSSKLYVTSGRRLWWLDLKSGAQATWAELSWPHEKVDGALCLEKSLGPYSCSSNGPNLFFIHGPNLYCYSSIDKLNAAKSLPQPQKVNSILGCSQ

Predicted Molecular Mass
52.9 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Hemopexin Protein, Rat (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Hemopexin Protein, Rat (His)
Cat. No.:
HY-P72236
Quantity:
MCE Japan Authorized Agent: