1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. HDHD2 Protein, Human (His)

Haloacid dehalogenase-like hydrolase domain-containing protein 2 (HDHD2) has hydrolase and phosphatase activities. HDHD2 is expressed in cerebellum and shift of HDHD2 modifications might be relative with depression.HDHD2 is well associated with ribosomal protein complex and regulates the protein synthesis and might has a neuroprotective function via activating the ribosomal activities. HDHD2 Protein, Human (His) is the recombinant human-derived HDHD2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Haloacid dehalogenase-like hydrolase domain-containing protein 2 (HDHD2) has hydrolase and phosphatase activities. HDHD2 is expressed in cerebellum and shift of HDHD2 modifications might be relative with depression.HDHD2 is well associated with ribosomal protein complex and regulates the protein synthesis and might has a neuroprotective function via activating the ribosomal activities. HDHD2 Protein, Human (His) is the recombinant human-derived HDHD2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

Haloacid dehalogenase-like hydrolase domain-containing protein 2 (HDHD2) is a member of haloacid dehydrogenase (HAD)-like superfamily with hydrolase and phosphatase activities. HDHD2 is expressed in cerebellum and shift of HDHD2 modifications might be relative with depression.HDHD2 is well associated with ribosomal protein complex and regulates the protein synthesis and might has a neuroprotective function via activating the ribosomal activities[1][2].

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9H0R4-1 (M1-L259)

Gene ID
Molecular Construction
N-term
6*His
HDHD2 (M1-L259)
Accession # Q9H0R4-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
Haloacid Dehalogenase-Like Hydrolase Domain-Containing Protein 2; HDHD2
AA Sequence

MAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTKESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHAVDHILQHLL

Predicted Molecular Mass
30.7 kDa
Molecular Weight

Approximately 30 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

HDHD2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HDHD2 Protein, Human (His)
Cat. No.:
HY-P70912
Quantity:
MCE Japan Authorized Agent: