1. Recombinant Proteins
  2. Others
  3. HCFC2 Protein, Mouse (His)

HCFC2 protein is critically involved in cellular processes by binding to KMT2A/MLL1 and participating in the MLL1/MLL complex. This complex, characterized by KMT2A/MLL1, ASH2L, RBBP5, DPY30, WDR5, MEN1, HCFC1, and HCFC2, plays a key role in epigenetic regulation and gene expression. HCFC2 Protein, Mouse (His) is the recombinant mouse-derived HCFC2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HCFC2 protein is critically involved in cellular processes by binding to KMT2A/MLL1 and participating in the MLL1/MLL complex. This complex, characterized by KMT2A/MLL1, ASH2L, RBBP5, DPY30, WDR5, MEN1, HCFC1, and HCFC2, plays a key role in epigenetic regulation and gene expression. HCFC2 Protein, Mouse (His) is the recombinant mouse-derived HCFC2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

The HCFC2 Protein plays a critical role in cellular processes by binding to KMT2A/MLL1 and functioning as a component of the MLL1/MLL complex. This complex, composed of KMT2A/MLL1, ASH2L, RBBP5, DPY30, WDR5, MEN1, HCFC1, and HCFC2, is involved in epigenetic regulation and gene expression. Additionally, HCFC2 interacts with TASOR, indicating its association with molecular complexes that contribute to various cellular functions. These interactions underscore the significance of HCFC2 in the intricate machinery of epigenetic regulation and chromatin modification.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

G5E837 (M1-E486)

Gene ID

67933  [NCBI]

Molecular Construction
N-term
6*His
HCFC2 (M1-E486)
Accession # G5E837
C-term
Protein Length

Partial

Synonyms
Host cell factor 2 ; HCF-2; C2 factor; Hcfc2
AA Sequence

MAAPSLLNWRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTVTNQWFLPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPQPPPSGFPPCPRLGHSFSLYGNKCYLFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSIPATKGVVPSPRESHTAIIYCKKDSASPKMYVFGGMCGARLDDLWQLDLETMSWSKPETKGTVPLPRSLHTASVIGNKMYIFGGWVPHKGENPETSPHDCEWRCTSSFSYLNLDTAEWTTLVSDSQEDKKNSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLWYLDTEKPPAPSQVQLIKATTNSFHVKWDEVPTVEGYLLQLNTDLTYQATSSDSSAAPSVLGGRMDPHRQGSNSTLHNSVSDTVNSTKTEHTAVRGTSLRSKPDSRAVDSSAALHSPLAPNTSNNSSWVTDMLRKNE

Predicted Molecular Mass
55.2 kDa
Molecular Weight

Approximately 55 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

HCFC2 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HCFC2 Protein, Mouse (His)
Cat. No.:
HY-P70906
Quantity:
MCE Japan Authorized Agent: