1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. HB-EGF Protein, Human (HEK293, His)

HB-EGF protein is a multifunctional growth factor that is regulated through EGFR, ERBB2 and ERBB4 and is critical for cardiac valve formation and cardiac function. It promotes smooth muscle cell proliferation and may contribute to macrophage-mediated cell proliferation. HB-EGF Protein, Human (HEK293, His) is the recombinant human-derived HB-EGF protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HB-EGF protein is a multifunctional growth factor that is regulated through EGFR, ERBB2 and ERBB4 and is critical for cardiac valve formation and cardiac function. It promotes smooth muscle cell proliferation and may contribute to macrophage-mediated cell proliferation. HB-EGF Protein, Human (HEK293, His) is the recombinant human-derived HB-EGF protein, expressed by HEK293 , with C-6*His labeled tag.

Background

HB-EGF Protein, a versatile growth factor, exerts its regulatory effects through EGFR, ERBB2, and ERBB4. Crucial for cardiac valve formation and normal heart function, HB-EGF plays a pivotal role in promoting smooth muscle cell proliferation and may contribute to macrophage-mediated cellular proliferation. Exhibiting mitogenic properties for fibroblasts while sparing endothelial cells, HB-EGF distinguishes itself by binding to EGF receptor/EGFR with greater affinity than EGF, emerging as a more potent mitogen for smooth muscle cells. Beyond its proliferative role, HB-EGF serves as a diphtheria toxin receptor and engages in interactions with FBLN1. The multifaceted interactions of HB-EGF with EGFR and ERBB4 underscore its central role in cellular regulation and cardiovascular development.

Biological Activity

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.6311 ng/mL, corresponding to a specific activity is 1.585×106 units/mg.

  • Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.6311 ng/mL , corresponding to a specific activity is 1.585×106 units/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q99075 (L20-L148)

Gene ID
Molecular Construction
N-term
HB-EGF (L20-L148)
Accession # Q99075
6*His
C-term
Protein Length

Full Length of Mature Protein (with N-Propeptide)

Synonyms
Proheparin-binding EGF-like growth factor; HB-EGF; DT-R; DTS; HEGFL
AA Sequence

LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

Molecular Weight

Approximately 17-27 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HB-EGF Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HB-EGF Protein, Human (HEK293, His)
Cat. No.:
HY-P72487
Quantity:
MCE Japan Authorized Agent: