1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. HAS2 Protein, Mouse (His)

The HAS2 protein adds GlcNAc or GlcUA monosaccharides to hyaluronic acid, playing a crucial role in its synthesis. HAS2 Protein, Mouse (His) is the recombinant mouse-derived HAS2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The HAS2 protein adds GlcNAc or GlcUA monosaccharides to hyaluronic acid, playing a crucial role in its synthesis. HAS2 Protein, Mouse (His) is the recombinant mouse-derived HAS2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

HAS2 protein plays a pivotal role in hyaluronan synthesis by catalyzing the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. As a key isozyme involved in this process, HAS2 contributes significantly to the formation of high molecular mass hyaluronan, a major component of most extracellular matrices. This hyaluronan polymer, with its structural role in tissue architectures, plays a crucial role in regulating cell adhesion, migration, and differentiation. HAS2's importance extends to developmental processes, as it is required for the transition of endocardial cushion cells into mesenchymal cells, a critical step in heart development. Additionally, HAS2 may play a role in vasculogenesis. The synthesis of high molecular mass hyaluronan by HAS2 is particularly noteworthy in early contact inhibition, a cellular process that halts growth upon cell contact with other cells or the extracellular matrix. In summary, HAS2 emerges as a central player in the intricate orchestration of hyaluronan-mediated cellular and developmental functions.

Biological Activity

1.Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 6.293 ng/mL, corresponding to a specific activity is 1.59×105 units/mg.
2.Measured by its ability to transfer GlcNAc and GlcA from donor substrates to Hyaluronan that incubate at 37°C for 20 min. The specific activity is 45.032 pmol/min/μg.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P70312 (E67-L374)

Gene ID
Molecular Construction
N-term
6*His
HAS2 (E67-L374)
Accession # P70312
C-term
Synonyms
Has2; Hyaluronan synthase 2; EC 2.4.1.212; Hyaluronate synthase 2; Hyaluronic acid synthase 2; HA synthase 2
AA Sequence

EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHL

Molecular Weight

Approximately 36-38 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 or 50 mM Tris-HCL, 200 mM NaCl, pH 8.0, 1 mM EDTA, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HAS2 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HAS2 Protein, Mouse (His)
Cat. No.:
HY-P72222
Quantity:
MCE Japan Authorized Agent: