1. Recombinant Proteins
  2. Others
  3. Haptoglobin Protein, Human (HEK293, His)

Haptoglobin captures and binds free plasma hemoglobin, preventing kidney damage and promoting hepatic recycling of heme iron. It acts as an antioxidant, exhibits antibacterial activity, and modulates various aspects of the acute phase response. Haptoglobin Protein, Human (HEK293, His) is the recombinant human-derived Haptoglobin protein, expressed by HEK293, with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Haptoglobin Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Haptoglobin captures and binds free plasma hemoglobin, preventing kidney damage and promoting hepatic recycling of heme iron. It acts as an antioxidant, exhibits antibacterial activity, and modulates various aspects of the acute phase response. Haptoglobin Protein, Human (HEK293, His) is the recombinant human-derived Haptoglobin protein, expressed by HEK293, with C-6*His labeled tag.

Background

The Haptoglobin protein functions to capture and bind free plasma hemoglobin, preventing kidney damage and enabling hepatic recycling of heme iron. During hemolysis, hemoglobin can accumulate in the kidneys and be secreted in urine. Additionally, Haptoglobin acts as an antioxidant, exhibits antibacterial activity, and plays a role in modulating various aspects of the acute phase response. The complexes formed between hemoglobin and Haptoglobin are efficiently cleared by the macrophage CD163 scavenger receptor on liver Kupfer cells through an endocytic lysosomal degradation pathway. Notably, the uncleaved form of the alpha-2 allele (2-2), known as zonulin, has implications in intestinal permeability by regulating intercellular tight junction disassembly and influencing the balance between tolerance and immunity to non-self antigens.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P00738-1 (V19-Q160&I162-N406)

Gene ID
Molecular Construction
N-term
Haptoglobin (V19-Q160&I162-N406)
Accession # P00738-1
6*His
C-term
Synonyms
rHuHaptoglobin/HP, His; Haptoglobin; Zonulin; HP
AA Sequence

VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQ&ILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN

Molecular Weight

16&40-75 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Haptoglobin Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Haptoglobin Protein, Human (HEK293, His)
Cat. No.:
HY-P70230
Quantity:
MCE Japan Authorized Agent: