1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. GSTM5 Protein, Human (N-His)

GSTM5 protein is pivotal in conjugating reduced glutathione to diverse hydrophobic electrophiles, crucial for cellular detoxification. Its enzymatic activity, addressing both exogenous and endogenous compounds, is essential for eliminating harmful substances and maintaining cellular homeostasis, highlighting GSTM5's protective role against toxic insults. GSTM5 Protein, Human (N-His) is the recombinant human-derived GSTM5 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GSTM5 protein is pivotal in conjugating reduced glutathione to diverse hydrophobic electrophiles, crucial for cellular detoxification. Its enzymatic activity, addressing both exogenous and endogenous compounds, is essential for eliminating harmful substances and maintaining cellular homeostasis, highlighting GSTM5's protective role against toxic insults. GSTM5 Protein, Human (N-His) is the recombinant human-derived GSTM5 protein, expressed by E. coli , with N-6*His labeled tag.

Background

GSTM5 protein plays a pivotal role in the cellular process of conjugating reduced glutathione to a broad spectrum of hydrophobic electrophiles, both originating from the cellular environment and generated endogenously. This enzymatic activity is fundamental for the detoxification and elimination of various harmful compounds within the cell, showcasing the essential role of GSTM5 in maintaining cellular homeostasis and protecting against potential toxic insults.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P46439 (M1-K218)

Gene ID
Molecular Construction
N-term
6*His
GSTM5 (M1-K218)
Accession # P46439
C-term
Protein Length

Full Length

Synonyms
Glutathione S-transferase Mu 5; GST class-mu 5; GSTM5-5; GSTM5
AA Sequence

MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK

Molecular Weight

Approximately 27 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01%Tween80, pH 7.4 or PBS, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

Data is not available.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GSTM5 Protein, Human (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GSTM5 Protein, Human (N-His)
Cat. No.:
HY-P75801
Quantity:
MCE Japan Authorized Agent: