1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. GSTM2 Protein, Human (N-His)

GSTM2 protein is pivotal in conjugating reduced glutathione to diverse hydrophobic electrophiles and actively participates in synthesizing hepoxilin regioisomers, as documented. This underscores GSTM2's multifunctional nature, emphasizing its role in detoxification and forming unique molecular species, contributing to the broader cellular response to various electrophilic compounds. GSTM2 Protein, Human (N-His) is the recombinant human-derived GSTM2, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GSTM2 protein is pivotal in conjugating reduced glutathione to diverse hydrophobic electrophiles and actively participates in synthesizing hepoxilin regioisomers, as documented. This underscores GSTM2's multifunctional nature, emphasizing its role in detoxification and forming unique molecular species, contributing to the broader cellular response to various electrophilic compounds. GSTM2 Protein, Human (N-His) is the recombinant human-derived GSTM2, expressed by E. coli , with N-6*His labeled tag.

Background

The GSTM2 protein plays a pivotal role in the cellular process of conjugating reduced glutathione to a diverse range of exogenous and endogenous hydrophobic electrophiles. Additionally, GSTM2 actively participates in the synthesis of novel hepoxilin regioisomers, as documented in studies. This highlights the multifunctional nature of GSTM2, emphasizing its involvement in the detoxification pathway and the formation of unique molecular species, contributing to the broader cellular response to various electrophilic compounds.

Biological Activity

10-15 U/mg, Bio-activity is defined as the amount of enzyme that conjugate 1.0 umole of 1-chloro-2,4-dinitrobenzene (CDNB) with reduced glutathione per minute at at 37°C.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P28161-1 (M1-K218)

Gene ID

2946

Molecular Construction
N-term
6*His
GSTM2 (M1-K218)
Accession # P28161-1
C-term
Synonyms
Glutathione S-transferase Mu 2; GST class-mu 2; GSTM2-2; GST4
AA Sequence

MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK

Molecular Weight

Approximately 26 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCL, 200 mM NaCl, 1mM CaCl2, pH 8.0, 10% trehalose, 0.02% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GSTM2 Protein, Human (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GSTM2 Protein, Human (N-His)
Cat. No.:
HY-P75152A
Quantity:
MCE Japan Authorized Agent: