1. Recombinant Proteins
  2. Receptor Proteins
  3. Growth Hormone R/GHR Protein, Rat (HEK293, His)

Growth Hormone R/GHR Protein, Rat (HEK293, His)

Cat. No.: HY-P73089
Handling Instructions Technical Support

Growth Hormone R/GHR Protein, a receptor for pituitary growth hormone, regulates postnatal body growth by activating the JAK2/STAT5 pathway upon ligand binding.Its soluble form, GHBP, acts as a plasma reservoir for growth hormone and potentially modulates or inhibits GH signaling.Growth Hormone R/GHR Protein, Rat (HEK293, His) is the recombinant rat-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Growth Hormone R/GHR Protein, a receptor for pituitary growth hormone, regulates postnatal body growth by activating the JAK2/STAT5 pathway upon ligand binding.Its soluble form, GHBP, acts as a plasma reservoir for growth hormone and potentially modulates or inhibits GH signaling.Growth Hormone R/GHR Protein, Rat (HEK293, His) is the recombinant rat-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-His labeled tag.

Background

The Growth Hormone R (GHR) protein functions as a receptor for pituitary gland growth hormone, playing a crucial role in the regulation of postnatal body growth. Upon binding with its ligand, GHR couples to and activates the JAK2/STAT5 signaling pathway. Additionally, the soluble form of GHR, known as GHBP (Growth Hormone Binding Protein), serves as a reservoir for growth hormone in the plasma and may function as a modulator or inhibitor of growth hormone signaling. The dynamic interplay between GHR and growth hormone underscores its pivotal role in the intricate regulation of physiological processes related to body growth.

Biological Activity

Measured by its ability to inhibit GH-induced proliferation of Nb2-11 rat lymphoma cells. The ED50 of this effect is 0.5495 ng/mL in the presence of 0.2 ng/mL GH, corresponding to a specific activity is 1.8198×106 units/mg.

Species

Rat

Source

HEK293

Tag

C-His

Accession

P16310-1 (F19-R265)

Gene ID
Molecular Construction
N-term
GHR (F19-R265)
Accession # P16310-1
His
C-term
Protein Length

Extracellular Domain

Synonyms
Growth hormone receptor; GH receptor GHBP; Ghr
AA Sequence

FPGSGATPATLGKASPVLQRINPSLRESSSGKPRFTKCRSPELETFSCYWTEGDDHNLKVPGSIQLYYARRIAHEWTPEWKECPDYVSAGANSCYFNSSYTSIWIPYCIKLTTNGDLLDEKCFTVDEIVQPDPPIGLNWTLLNISLPGIRGDIQVSWQPPPSADVLKGWIILEYEIQYKEVNETKWKTMSPIWSTSVPLYSLRLDKEHEVRVRSRQRSFEKYSEFSEVLRVTFPQMDTLAACEEDFR

Molecular Weight

35-45 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Growth Hormone R/GHR Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Growth Hormone R/GHR Protein, Rat (HEK293, His)
Cat. No.:
HY-P73089
Quantity:
MCE Japan Authorized Agent: