1. Recombinant Proteins
  2. Receptor Proteins
  3. Growth Hormone R/GHR Protein, Rat (HEK293, Fc)

Growth Hormone R/GHR Protein, Rat (HEK293, Fc)

Cat. No.: HY-P73088
Handling Instructions Technical Support

Growth Hormone R/GHR Protein, a receptor for pituitary growth hormone, regulates postnatal body growth by activating the JAK2/STAT5 pathway upon ligand binding.Its soluble form, GHBP, acts as a plasma reservoir for growth hormone and potentially modulates or inhibits GH signaling.Growth Hormone R/GHR Protein, Rat (HEK293, Fc) is the recombinant rat-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Growth Hormone R/GHR Protein, a receptor for pituitary growth hormone, regulates postnatal body growth by activating the JAK2/STAT5 pathway upon ligand binding.Its soluble form, GHBP, acts as a plasma reservoir for growth hormone and potentially modulates or inhibits GH signaling.Growth Hormone R/GHR Protein, Rat (HEK293, Fc) is the recombinant rat-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The Growth Hormone R (GHR) protein functions as a receptor for pituitary gland growth hormone, playing a crucial role in the regulation of postnatal body growth. Upon binding with its ligand, GHR couples to and activates the JAK2/STAT5 signaling pathway. Additionally, the soluble form of GHR, known as GHBP (Growth Hormone Binding Protein), serves as a reservoir for growth hormone in the plasma and may function as a modulator or inhibitor of growth hormone signaling. The dynamic interplay between GHR and growth hormone underscores its pivotal role in the intricate regulation of physiological processes related to body growth.

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

P16310-1 (F19-R265)

Gene ID
Molecular Construction
N-term
GHR (F19-R265)
Accession # P16310-1
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Growth hormone receptor; GH receptor GHBP; Ghr
AA Sequence

MDLWRVFLTLALAVSSDMFPGSGATPATLGKASPVLQRINPSLRESSSGKPRFTKCRSPELETFSCYWTEGDDHNLKVPGSIQLYYARRIAHEWTPEWKECPDYVSAGANSCYFNSSYTSIWIPYCIKLTTNGDLLDEKCFTVDEIVQPDPPIGLNWTLLNISLPGIRGDIQVSWQPPPSADVLKGWIILEYEIQYKEVNETKWKTMSPIWSTSVPLYSLRLDKEHEVRVRSRQRSFEKYSEFSEVLRVTFPQMDTLAACEEDFR

Molecular Weight

Approximately 66 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Growth Hormone R/GHR Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Growth Hormone R/GHR Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P73088
Quantity:
MCE Japan Authorized Agent: