1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Granzyme B/GZMB Protein, Human (227a.a, HEK293, His)

Granzyme B/GZMB Protein, Human (227a.a, HEK293, His)

Cat. No.: HY-P703940
Handling Instructions Technical Support

Granzyme B (GZMB) is a cytosolic protease enriched in cytotoxic T cells and natural killer cells and is critical for immune defense. Upon delivery to target cells, GZMB activates caspase-independent pyroptosis by cleaving gasdermin-E (GSDME). Granzyme B/GZMB Protein, Human (227a.a, HEK293, His) is the recombinant human-derived Granzyme B/GZMB protein, expressed by HEK293, with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Granzyme B (GZMB) is a cytosolic protease enriched in cytotoxic T cells and natural killer cells and is critical for immune defense. Upon delivery to target cells, GZMB activates caspase-independent pyroptosis by cleaving gasdermin-E (GSDME). Granzyme B/GZMB Protein, Human (227a.a, HEK293, His) is the recombinant human-derived Granzyme B/GZMB protein, expressed by HEK293, with C-6*His labeled tag.

Background

Granzyme B (GZMB) is a highly abundant protease residing in the cytosolic granules of cytotoxic T-cells and natural killer cells, playing a pivotal role in immune defense mechanisms. Upon delivery into the target cell through the immunological synapse, GZMB activates caspase-independent pyroptosis by catalyzing the cleavage of gasdermin-E (GSDME). This results in the release of the pore-forming moiety of GSDME, triggering pyroptosis and ultimately leading to target cell death. GZMB exhibits a substrate specificity for cleavage after aspartate residues. Additionally, it is implicated in an activation cascade of caspases, including caspase-3, -9, and -10, thereby contributing to apoptosis execution. Moreover, GZMB is involved in the response to bacterial infection, where it cleaves and activates caspase-7, promoting plasma membrane repair. The multifaceted activities of GZMB highlight its crucial role in orchestrating immune responses and cellular defense mechanisms.

Biological Activity

Measured by its ability to cleave the fluorogenic peptide substrate,Ac-IETD-pNA. The specific activity is 400.3±1.556 mOD/min/ug.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P10144 (I21-Y247)

Gene ID

3002

Molecular Construction
N-term
Granzyme B/GZMB (I21-Y247)
Accession # P10144
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Granzyme B; CTLA-1; CCP1; Fragmentin-2; Gzmb
AA Sequence

IIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY

Molecular Weight

Predicted band size: 26.6 kDa; Observed band size: 32-42 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH7.4 or 20 mM PB,300 mM NaCl,8% Sucrose,pH7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Granzyme B/GZMB Protein, Human (227a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Granzyme B/GZMB Protein, Human (227a.a, HEK293, His)
Cat. No.:
HY-P703940
Quantity:
MCE Japan Authorized Agent: