Granzyme B/GZMB Protein, Human (227a.a, HEK293, His)

Granzyme B (GZMB) is a cytosolic protease enriched in cytotoxic T cells and natural killer cells and is critical for immune defense. Upon delivery to target cells, GZMB activates caspase-independent pyroptosis by cleaving gasdermin-E (GSDME). Granzyme B/GZMB Protein, Human (227a.a, HEK293, His) is the recombinant human-derived Granzyme B/GZMB protein, expressed by HEK293, with C-6*His labeled tag.

Granzyme B (GZMB) is a highly abundant protease residing in the cytosolic granules of cytotoxic T-cells and natural killer cells, playing a pivotal role in immune defense mechanisms. Upon delivery into the target cell through the immunological synapse, GZMB activates caspase-independent pyroptosis by catalyzing the cleavage of gasdermin-E (GSDME). This results in the release of the pore-forming moiety of GSDME, triggering pyroptosis and ultimately leading to target cell death. GZMB exhibits a substrate specificity for cleavage after aspartate residues. Additionally, it is implicated in an activation cascade of caspases, including caspase-3, -9, and -10, thereby contributing to apoptosis execution. Moreover, GZMB is involved in the response to bacterial infection, where it cleaves and activates caspase-7, promoting plasma membrane repair. The multifaceted activities of GZMB highlight its crucial role in orchestrating immune responses and cellular defense mechanisms.

Human

HEK293

C-6*His

P10144 (I21-Y247)

3002

Full Length of Mature Protein

IIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY

Predicted band size: 26.6 kDa; Observed band size: 32-42 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of PBS, pH7.4 or 20 mM PB,300 mM NaCl,8% Sucrose,pH7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.